Articles tagged with "energy"
US fast-tracks nuclear reactor testing to catch up with China’s boom
The United States Department of Energy (DOE) has launched a pilot program to accelerate the testing and commercial licensing of advanced nuclear reactors, aiming to catch up with China’s rapid nuclear energy expansion. This initiative, authorized under President Donald Trump’s executive order on reforming nuclear reactor testing, allows private companies to construct and operate test reactors outside national laboratories. The program seeks to streamline development by requiring applicants to demonstrate technological readiness, financial viability, and a plan to achieve reactor criticality by July 4, 2026. Selected companies will bear all costs related to design, construction, operation, and decommissioning, with applications due by July 21, 2025. This move is part of a broader effort to boost American innovation in nuclear technology, enhance economic growth, and strengthen national security. It builds on existing DOE and Department of Defense projects involving microreactors and advanced reactor demonstrations. The urgency stems from China’s aggressive nuclear expansion, which includes 102 reactors operating, under construction, or approved
energynuclear-energyadvanced-reactorsDOEnuclear-reactor-testingenergy-policyclean-energyHow Much Energy Does AI Use? The People Who Know Aren’t Saying
The article discusses the opaque nature of energy consumption data related to AI, particularly large language models like ChatGPT. OpenAI CEO Sam Altman claimed that an average ChatGPT query uses about 0.34 watt-hours of energy, roughly equivalent to a high-efficiency lightbulb running for a couple of minutes. However, experts criticize this figure for lacking transparency and context, such as whether it includes energy used for training models, server cooling, or image generation. OpenAI has not provided detailed disclosures explaining how this number was calculated, leading to skepticism among researchers like Sasha Luccioni from Hugging Face, who emphasizes the need for more comprehensive environmental transparency in AI. The article highlights a broader issue: most AI models in use today do not disclose their environmental impact, with 84% of large language model traffic in May 2025 coming from models with zero environmental disclosure. This lack of transparency hampers efforts to accurately assess AI’s carbon footprint, especially as AI usage grows rapidly. Misleading
energyartificial-intelligenceAI-energy-consumptioncarbon-emissionsenvironmental-impactenergy-transparencyclimate-changeHot New Lynk & Co 08 Goes On Sale Across Europe - CleanTechnica
Lynk & Co, a relatively young electric vehicle (EV) brand known for its sleek, tech-forward designs, has officially launched its new model, the Lynk & Co 08, across Europe. Unlike many EV brands focused solely on pure electric vehicles, Lynk & Co emphasizes plug-in hybrid electric vehicles (PHEVs), blending practicality with innovation. The 08 model is a €53,000 plug-in hybrid SUV offering a notable 200 km (124 miles) of electric-only range and fast DC charging capabilities, which are industry firsts in Europe. It boasts a total driving range exceeding 1,100 km and promises a combination of performance, sustainability, and convenience tailored for modern lifestyles. The Lynk & Co 08 is positioned as a high-tech, luxurious vehicle featuring advanced safety systems such as an ADAS suite, matrix LED headlights, and a 360-degree camera. Its design focuses on both aesthetics and efficiency, with aerodynamic sculpted sides, frameless windows,
energyelectric-vehiclesplug-in-hybridEV-chargingautomotive-technologysustainabilityadvanced-driver-assistance-systemsU.S. EIA Forecasts New Export Licensing Requirements Will Reduce U.S. Ethane Exports - CleanTechnica
The U.S. Energy Information Administration (EIA) forecasts a significant decline in U.S. ethane exports due to newly imposed export licensing requirements targeting shipments to China. Specifically, exports are expected to drop by 80,000 barrels per day (b/d) in 2025 and by 177,000 b/d in 2026. This reduction stems from the U.S. Department of Commerce’s Bureau of Industry and Security (BIS) requiring special licenses for ethane exports to China, citing concerns that ethane could be used for military purposes. China, which accounted for 47% of U.S. ethane exports in 2024, receives all its ethane from two Gulf Coast terminals operated by Enterprise and Energy Transfer in Texas. The licensing restrictions have led to delays and idling of several Very Large Ethane Carriers (VLECs) that were destined for China. Ethane, a byproduct extracted during natural gas processing, is primarily used to produce ethylene
energyethane-exportspetrochemical-industryethylene-productionU.S.-Energy-Information-Administrationexport-licensingglobal-energy-tradeThe Aviation Industry and the Stall in Aircraft Innovation - CleanTechnica
The article from CleanTechnica highlights a concerning stall in aircraft innovation that threatens the aviation industry’s ability to meet decarbonisation targets. Despite the critical need for more efficient and zero-emission aircraft to reduce the sector’s high emissions, major manufacturers like Airbus and Boeing have largely focused on incremental improvements, such as re-engined versions of existing models, rather than breakthrough technologies. Innovative projects have faced delays or pauses, and no new aircraft models are expected from these OEMs in the next decade. This slowdown is attributed to a lack of market competition and insufficient policy incentives pushing manufacturers toward radical innovation. Modeling presented in the article suggests that with ambitious but achievable innovation, European aviation could improve efficiency by up to 13% by 2050, potentially saving enough renewable electricity to power 27 million heat pumps. If manufacturers push further, efficiency gains could reach 17%, underscoring the significant role aircraft technology can play in meeting EU climate goals. To unlock this potential, the article recommends strengthening
energyaviationdecarbonizationsustainable-aviation-fuelsaircraft-innovationemissions-reductiongreen-technologyIsrael hits Iran’s heavy-water reactor as Trump weighs attack plans
Tensions between Israel and Iran have sharply escalated following a series of missile strikes, with Israel reportedly launching airstrikes on Iran’s Arak heavy water reactor. Iranian state media confirmed the attack but assured there was no radiation danger, noting the facility had been evacuated beforehand. Israel warned civilians to evacuate the area prior to the strike, and in retaliation, Iran fired missiles targeting multiple locations in Israel, including a medical building and residential apartments. This exchange marks the seventh consecutive day of Israeli airstrikes on Iranian nuclear-related sites such as Natanz and Isfahan, with Iran responding in kind and urging civilians to seek shelter. The Arak reactor, located southwest of Tehran, uses heavy water to cool its nuclear reactor and, despite redesigns under the 2015 nuclear deal to reduce proliferation risks, remains a potential source for plutonium production, which could aid nuclear weapons development. The International Atomic Energy Agency (IAEA) has reported a loss of “continuity of knowledge” at Ar
energynuclear-reactorheavy-waterIranIsraelmissile-strikesnuclear-proliferationSolar Panels Give Edge to Tomatoes Grown Underneath - CleanTechnica
Researchers at the U.S. Department of Energy’s National Renewable Energy Laboratory (NREL) conducted experiments to determine if tomatoes grown under specially designed light filters would perform better than those grown under full sunlight. These filters, based on organic photovoltaic (OPV) technology, selectively transmit only the light spectrum most beneficial to the plants while potentially converting unused light into electricity. In a controlled study, tomato plants grown under these purplish BioMatched panels grew faster and larger than those exposed to the full solar spectrum, demonstrating that tailoring light exposure to a plant’s physiological needs can enhance growth. This project, part of the multi-disciplinary “No Photon Left Behind” initiative, builds on earlier successful experiments with algae, where BioMatched filters also increased growth rates despite reducing overall light exposure. The algae research showed higher efficiency in converting photons to biomass, encouraging researchers to test similar approaches with crops. While the current OPV filters used in the experiments do not generate electricity, the ultimate aim is to integrate BioMatched materials into
energysolar-panelsphotovoltaic-cellsorganic-semiconductorsplant-growthbioenergyrenewable-energyBloomberg 2025 Electric Vehicle Outlook Report - CleanTechnica
The Bloomberg 2025 Electric Vehicle (EV) Outlook Report, produced by Bloomberg New Energy Finance (BNEF), provides a comprehensive global analysis of the EV market, covering vehicle sales, oil markets, electricity demand, charging infrastructure, batteries, metals, and CO2 emissions. The report highlights that plug-in EVs are projected to account for one in four new passenger vehicles sold worldwide in 2025, with China leading the market by having EVs cheaper on average than comparable combustion vehicles. In China, extended-range plug-in hybrid sales surged over 83% in 2024, driven largely by rural customers purchasing SUVs with substantial electric-only range, reflecting strong EV adoption despite limited charging infrastructure. However, the report also identifies challenges ahead, particularly in the US and Europe. The cost of public fast charging has risen sharply since 2022, now matching or exceeding gasoline prices, which undermines the economic incentives for EV adoption where purchase prices remain higher than conventional cars. Battery production is dominated by
energyelectric-vehiclesEV-chargingbatteriesrenewable-energyelectric-mobilityclean-technologyCanon Alpha EREV Ute — Can It Be The #1 Big Shot? - CleanTechnica
Great Wall Motors has introduced the Canon Alpha EREV (Extended Range Electric Vehicle) ute to the Australian market as a competitor to the BYD Shark, targeting the country’s substantial ute segment where one in eight vehicles sold are light trucks. The Canon Alpha EREV is a large vehicle with dimensions comparable to Tesla’s Cybertruck and BYD’s Shark, featuring a 37.1 kWh lithium battery paired with a 2-litre turbo petrol engine. Its electric-only range is similar to the Shark, though it is priced about AU$9,000 higher. Compared to the diesel version, the EREV costs roughly AU$10,000 more but offers significant fuel savings given Australia’s high diesel prices and new emissions regulations, emitting just 39g/km CO2 versus over 200g/km for diesel and hybrid versions. The ute also includes off-road capabilities such as a rear differential lock, enhancing its traditional utility. The Canon Alpha EREV has been on sale in Australia for about a month
energyelectric-vehicleextended-range-electric-vehiclelithium-batteryemissions-reductionautomotive-technologyclean-energyInside The Iberian Grid Collapse: What Really Went Wrong - CleanTechnica
On April 28, 2025, the Iberian Peninsula suffered a major blackout when the Spain and Portugal grids disconnected from the wider European system due to a cascading failure at 12:33 PM. Despite occurring during mild spring conditions with moderate demand and abundant renewable energy, the blackout was not caused by renewables themselves. Instead, it resulted from multiple failures: 50% due to human errors in planning, 30% from legacy generation units not performing as expected, and 20% from renewables disconnecting because they were not configured to handle the scenario—highlighting human and system design shortcomings rather than technological faults. Prior black-start procedures, relying heavily on hydroelectric plants with autonomous restart capabilities, were successfully executed to restore the grid, underscoring the continued importance of such resources even as battery storage and inverter-based technologies grow. The blackout was precipitated by persistent voltage fluctuations and frequency oscillations throughout the morning, revealing structural weaknesses like insufficient dynamic voltage regulation and poor oscillation damping.
energypower-gridrenewable-energyblackoutelectricity-systemgrid-stabilityhydroelectric-powerUS battery breakthrough boasts 1,300 cycles and zero Chinese materials
Boston-based startup Pure Lithium, led by CEO Emilie Bodoin, has developed a lithium metal battery that promises significant advancements over conventional lithium-ion cells. The battery boasts over 1,300 charge-discharge cycles and eliminates reliance on critical minerals such as graphite, cobalt, nickel, and manganese—materials often sourced or processed in China. Instead, Pure Lithium uses a proprietary “Brine to Battery” process to extract pure lithium metal anodes directly from brine, paired with a vanadium cathode that enhances fire resistance and allows operation at temperatures up to 700°C. This design not only improves energy density but also reduces material costs and environmental concerns associated with traditional lithium-ion batteries. This innovation comes amid growing U.S. efforts to reduce dependence on China, which currently dominates around 90% of global rare earth production and supplies half of America’s critical mineral imports. Pure Lithium’s approach aligns with national priorities to secure domestic supply chains for clean energy technologies. The company is expanding its lithium production and
energylithium-batterybattery-technologymaterials-scienceenergy-storageclean-energysupply-chain-independenceReclaiming Coal Country: 300 GW Solar Goldmine From Coal Mine Conversions - CleanTechnica
A recent report by Global Energy Monitor (GEM) highlights the significant potential of converting closed and soon-to-be-retired coal mines into solar farms, estimating an increase of nearly 300 gigawatts (GW) in global solar capacity by 2030—equivalent to a 15% rise over current installed solar power. The study, “Bright Side of the Mine,” analyzes over 300 surface coal mines closed since 2020 and 127 projected closures by 2030, identifying more than 5,800 square kilometers of degraded mine land suitable for solar development. Nearly all these sites are within 10 kilometers of existing grid infrastructure, facilitating rapid deployment. This transition could generate approximately 577,000 jobs worldwide, including both permanent and construction roles, potentially offsetting coal sector job losses by 2035. The report emphasizes major coal-producing countries such as China, Australia, the U.S., India, South Africa, and Indonesia as key regions for this transformation. India alone could develop
energysolar-energycoal-mine-conversionrenewable-energyclean-energyjob-creationenergy-transitionThe Baojun Yep Plus — I Mean, the Chevrolet Spark EUV — Lands in Mexico. Will This Turn the Tide for GM? - CleanTechnica
The article discusses General Motors' (GM) strategic move to introduce the Baojun Yep Plus, marketed as the Chevrolet Spark EUV, into the Mexican market as part of its effort to compete against rising Chinese electric vehicle (EV) manufacturers in Latin America. China has emerged as the global leader in EV production, with Chinese automakers rapidly expanding into international markets, including Latin America, where affordable EV options are increasingly available. GM, which has a significant presence in Latin America with local production facilities in Mexico, Argentina, and Brazil, has traditionally focused on internal combustion engine vehicles (ICEVs) tailored to developing markets. However, facing growing competition from Chinese EV brands like BYD, GM is leveraging its manufacturing capacity in China and the efficient supply chains there to offer competitive EV models abroad. The Chevrolet Spark EUV is a compact, SUV-styled EV featuring a 42 kWh battery with an EPA range of 281 km and a price point of approximately USD 23,600 in Mexico. This
energyelectric-vehiclesEV-marketChevrolet-Spark-EUVbattery-technologyautomotive-industryLatin-America100-lane expressway for light: China's optical chip hits record speeds
Chinese researchers at the Shanghai Institute of Optics and Fine Mechanics (SIOM) have developed an ultra-high-parallel optical computing chip capable of a theoretical 2,560 tera-operations per second (TOPS) at a 50 GHz optical clock rate. Unlike conventional optical processors that use a single wavelength of light, this chip employs a 100-wavelength architecture, effectively creating a "100-lane expressway" for data transmission. This is achieved through soliton microcomb sources that split a continuous laser into over a hundred distinct spectral channels, allowing massive parallelism without increasing clock speed or chip size. The chip offers low insertion loss, wide optical bandwidth, and fully reconfigurable routing, making it suitable for applications such as image recognition, real-time signal processing, and artificial intelligence (AI). The design's high parallelism and energy efficiency position it as a promising alternative to traditional GPUs, particularly for AI workloads that require numerous identical operations. Its low latency and power efficiency also make it attractive
energyoptical-chiphigh-speed-computingartificial-intelligencephotonic-technologylow-latency-processingedge-devicesxAI is facing a lawsuit for operating over 400 MW of gas turbines without permits
xAI’s Colossus data center near Memphis is facing a lawsuit from the Southern Environmental Law Center (SELC), acting on behalf of the NAACP, for operating over 400 megawatts of natural gas turbines without the required preconstruction or operating air pollution permits. SELC alleges that xAI installed and ran at least 35 combustion turbines over the past year without regulatory approval, violating the Clean Air Act. These turbines have the potential to emit over 2,000 tons of nitrogen oxides (NOx) annually, pollutants that contribute to smog and exacerbate respiratory issues. Memphis already struggles with poor air quality and high asthma rates, making the unpermitted emissions a significant public health concern. Despite local health authorities initially claiming the turbines were exempt from permitting, SELC’s investigation—including aerial and thermal imaging—confirmed extensive turbine operation without proper permits or pollution controls. Although some turbines have been removed recently, around 26 remain operational, maintaining a generating capacity near 407 megawat
energygas-turbinesair-pollutionClean-Air-Actnatural-gasemissionsdata-center-energy-useThe US Solar Energy Whack-A-Mole Continues
The article discusses the challenges and ongoing developments in the US solar energy sector amid shifting federal energy policies that threaten to hinder growth. Despite political obstacles, energy consumers continue to adopt cost-effective and abundant solar solutions, exemplified by a new concentrating solar power (CSP) project in California. This project, a partnership between GlassPoint and Searles Valley Minerals (SVM), aims to replace the last two coal power plants in California by providing reliable, round-the-clock clean power. The initiative is notable not only for its environmental benefits but also for supporting local jobs, reducing costs, and securing domestic supply chains for critical minerals like boron, which SVM will uniquely produce in the US after Rio Tinto Borates winds down operations. GlassPoint specializes in CSP technology that uses mirrors to concentrate sunlight to generate thermal energy, producing steam for industrial processes rather than electricity directly. This approach targets a $444 billion industrial process heat market, with strong global demand from sectors such as metals, mining, and oil
energysolar-energyconcentrating-solar-powerclean-energycoal-powerindustrial-process-heatcritical-materialsRussia to use submarines with nuclear reactors to supply gas via Arctic
Russia is developing nuclear-powered submarines equipped with three Rhythm-200 nuclear reactors to transport liquefied natural gas (LNG) via the Northern Sea Route (NSR) in the Arctic. These submarines, designed by the Kurchatov Institute, aim to reduce transit times from 20 to 12 days by traveling at speeds of about 17 knots beneath the ice, enabling year-round gas transportation from Arctic terminals. The project is seen as a potential alternative to traditional surface LNG carriers and pipelines, with Russian officials and President Vladimir Putin endorsing its feasibility and efficiency. Despite the ambitious plans, analysts express skepticism about Russia's ability to deliver the submarines due to capacity constraints in nuclear submarine design and the impact of Western sanctions on investment and infrastructure development along the NSR. Significant upgrades to Arctic ports and related facilities are necessary for the route to become competitive. The Russian government plans to increase the Arctic Basin's port capacity by over 34 million tons by 2030, reflecting a broader
energynuclear-reactorsLNG-transportationArctic-shippingsubmarinesNorthern-Sea-Routemaritime-energy-transportSyncraft Builds High-Altitude Climate Positive Power Plant In The Swiss Alps - CleanTechnica
The article highlights a pioneering decentralized renewable energy project in the Swiss Alps by the cleantech company SYNCRAFT. The Engadine installation converts local forest residues into renewable electricity, usable heat, and biogenic carbon (biocoal), making it a climate-positive power plant. This approach not only generates clean energy but also sequesters carbon in solid form, contributing to long-term carbon dioxide removal (CDR) and supporting net-negative emissions goals. Central to the project is the CW1800-500 system, which integrates with existing infrastructure such as boilers and Organic Rankine Cycle (ORC) units. SYNCRAFT Automation’s advanced control platform is a key feature, enabling real-time data exchange, thermal circuit control, heat load balancing, indoor ventilation coordination, and overall system efficiency optimization. Despite the challenges of high-altitude construction, SYNCRAFT’s engineering teams have progressed with assembly, including pipework, electrical systems, and automation deployment. Manufactured in Europe to high industrial standards, the
energyrenewable-energybiomasscarbon-captureautomationclimate-positivepower-plantSweden's Largest Fund Dumps Tesla (TSLA) Shares & Blacklists Company - CleanTechnica
Sweden's largest pension fund, AP7, has divested entirely from Tesla and blacklisted the company due to verified violations of labor rights in the United States, which conflict with AP7’s environmental, social, and governance (ESG) criteria. AP7, a state-managed fund serving 5.9 million savers and known for above-average returns, included Tesla among five companies recently blacklisted for failing to meet ESG standards. The other blacklisted firms primarily involve large-scale oil and coal operations that do not align with the Paris Agreement targets. AP7 has blacklisted a total of 114 companies but also removed one, Evergy, Inc., after it took sufficient transition measures. AP7’s decision followed several years of dialogue and shareholder proposals aimed at addressing Tesla’s labor issues, which the company has not adequately resolved. Although the blacklisting relates specifically to labor rights violations in the U.S., AP7 clarified that ongoing labor conflicts involving Tesla in Sweden did not influence their decision, though
energyTeslaESGlabor-rightsblacklistingsustainable-investingclean-energyBig Oil Has A Plan - Waste As Much Energy As Possible - CleanTechnica
The article discusses recent actions by the U.S. government, specifically the elimination and de-prioritization of the Energy Star program by the EPA under the Trump administration. Energy Star, a bipartisan initiative started by Republicans, has been highly effective in saving consumers money—$14 billion in 2024 alone—and significantly reducing carbon emissions since 1992. The program’s termination is seen as a deliberate move to slow the transition to renewable energy and prolong fossil fuel dependence, benefiting incumbent energy producers like Big Oil. Environmentalist Bill McKibben highlights that such policies appear designed to waste energy, aligning with fossil fuel industry interests that historically favor energy inefficiency to maintain market dominance. The article also contrasts this approach with the preferences of businesses globally, where 97% reportedly favor switching to renewable energy due to its efficiency, cost stability, and reduced geopolitical risks. McKibben criticizes the U.S. government’s contradictory stance, citing a Department of Energy goal to increase fossil fuel exports and foreign
energyfossil-fuelsrenewable-energyEnergy-Star-programemissions-reductionenergy-policyclimate-changeFirst US nuclear reactor in 50 years to supply power where grids can’t
The U.S. Department of Energy (DOE) is advancing the development of advanced microreactor technology through the MARVEL project, the first U.S. nuclear reactor in 50 years designed to supply power and heat in remote locations where traditional grids are unavailable. Managed by Idaho National Laboratory (INL), MARVEL is an 85-kW thermal, 20-kW electric test reactor cooled by a sodium-potassium (NaK) alloy. It uses uranium hydride fuel rods moderated by hydrogen and surrounded by a beryllium reflector, employing existing technologies and off-the-shelf components for faster construction. The reactor is located at INL’s Transient Reactor Test Facility (TREAT) and aims to serve as a physical test bed for integrated testing of reactor components, autonomous controls, microgrid interfaces, and process heat applications in a real nuclear environment. MARVEL’s development is divided into three phases over approximately five years. The first phase, currently underway, focuses on finalizing design,
energynuclear-reactormicroreactoradvanced-nuclear-technologyDepartment-of-Energymicrogridsodium-potassium-coolantMillions To Be Invested In Blue Economy Projects In “Big Ocean States” - CleanTechnica
The article discusses a significant investment initiative targeting the sustainable development of island and coastal economies, particularly Small Island Developing States (SIDS), which are highly vulnerable to climate change impacts such as sea-level rise, flooding, and storm damage. Outrigger Impact, a new fund supported by the UK Government’s Blue Planet Fund, the Global Environment Facility, and other donors, plans to invest over $5 million initially in grants and repayable loans to help island-based enterprises become investment-ready. The long-term goal is to scale up investments to $100 million to foster sustainable and resilient economies, conserve biodiversity, and enhance marine ecosystems through regenerative blue economy projects. Catalytic capital, which is patient and risk-tolerant finance designed to attract additional traditional investors by absorbing initial risks, plays a central role in this strategy. The sustainable blue economy encompasses ocean conservation, sustainable seafood, low-carbon shipping, and renewable ocean energy, all vital for the economic and ecological health of island states. SIDS control about 30%
energyrenewable-ocean-energyblue-economysustainable-seafoodocean-conservationclimate-resilienceisland-economiesNovel film improves life of anode-free solid-state battery by 7 times
Researchers at the Korea Research Institute of Chemical Technology (KRICT) have developed a novel molybdenum disulfide (MoS2) thin film coating that significantly enhances the lifespan and stability of anode-free all-solid-state batteries (AFASSBs). By applying MoS2 nanosheets onto stainless steel current collectors via metal-organic chemical vapor deposition (MOCVD), the team created a cost-effective, scalable alternative to expensive noble metal coatings. This MoS2 layer acts as a sacrificial buffer that reacts with lithium during battery cycling, forming a stable interfacial layer of molybdenum metal and lithium sulfide (Li2S). This dynamic interface improves lithium affinity, prevents dendrite formation, and boosts capacity retention by seven times, enabling stable operation for over 300 hours and tripling battery runtime. The innovation addresses key challenges in AFASSBs, which eliminate the anode to reduce cell volume and increase energy density but suffer from interfacial instability and dendrite growth
energysolid-state-batteriesanode-free-batteriesmolybdenum-disulfidebattery-materialsbattery-technologycapacity-retentionGerman nuclear plant removes 1,200-ton generators without disassembly
The Unterweser nuclear power plant in Germany has successfully removed four massive steam generators, each weighing approximately 300 tons and standing 20 meters tall, using an innovative heavy lift system without disassembly. Operated by PreussenElektra, the plant was notable for holding world records in power generation before its shutdown in 2011 as part of Germany’s nuclear phase-out. The steam generators were lifted out with precision and high safety standards using Mammoet’s DHS-500 handling system, which allowed for efficient removal by combining with existing cranes and hydraulic skidding, avoiding more time-consuming transport methods. Following removal, the steam generators are scheduled to be shipped to Cyclife in Sweden in July for on-site dismantling and subsequent melting. PreussenElektra is also managing the decommissioning of several other German nuclear plants and has contracted Cyclife for dismantling 16 steam generators across multiple sites. The successful use of the DHS-500 system at Unterweser, building on prior experience
energynuclear-powersteam-generatorspower-plant-decommissioningheavy-lifting-technologyMammoet-DHS-500electricity-generationMIT builds new superconducting chip to power future quantum computers
Researchers at MIT’s Plasma Science and Fusion Center have developed a superconducting diode (SD)-based rectifier chip that converts alternating current (AC) to direct current (DC) at cryogenic temperatures, aiming to streamline power delivery in superconducting classical and quantum computers. This innovation addresses a critical challenge in quantum computing: reducing thermal and electromagnetic noise caused by numerous wires connecting ultra-cold components to ambient temperature systems. By integrating four superconducting diodes on a single chip, the team achieved efficient AC to DC conversion, potentially enhancing qubit stability and reducing interference, which is vital for the practical realization of quantum computers. Beyond quantum computing, the superconducting diode technology has broader applications, including serving as isolators or circulators to protect qubit signals and playing a role in dark matter detection circuits used in experiments at CERN and Berkeley National Laboratory. This advancement promises to make superconducting electronics more energy-efficient and practical, potentially revolutionizing computing power in the era of increasing demands from technologies like artificial intelligence. The
energysuperconducting-electronicsquantum-computingsuperconducting-diodepower-efficiencycryogenic-technologyMIT-research1,250-hp US hypercar beast hits 60 mph faster than most can blink
General Motors has unveiled the 2026 Corvette ZR1X, a groundbreaking hybrid hypercar that delivers an astonishing 1,250 horsepower and accelerates from 0 to 60 mph in just 1.99 seconds, rivaling elite European track-focused cars like the Bugatti Bolide. The ZR1X features a hand-assembled 5.5-liter LT7 flat-plane V8 engine producing 1,064 hp and 828 lb-ft of torque—the most powerful V8 ever made by an American automaker—augmented by a front-axle electric motor adding 186 hp and 145 lb-ft. This all-wheel-drive system, paired with an eight-speed dual-clutch transmission and a compact 1.9-kWh battery recharged via regenerative braking, enables the car to complete the quarter-mile in under 9 seconds at speeds over 150 mph. Built from the ground up with the ZR1X in mind, the mid-engine Corvette platform balances extreme
energyhybrid-technologyelectric-motorregenerative-brakinghigh-performance-batteryautomotive-engineeringelectric-vehiclesUS brings out rare nuclear sniffer jet amid Iran-Israel war
The U.S. Air Force has deployed its rare WC-135R "Constant Phoenix" aircraft, known as the "nuclear sniffer," amid escalating tensions between Iran and Israel, particularly following reports of Israeli strikes on Iranian nuclear sites and Tehran’s threats of retaliation. The WC-135R is the only airborne platform globally dedicated to atmospheric collection missions under the Limited Nuclear Test Ban Treaty of 1963. Operated by the 45th Reconnaissance Squadron and supported by the Air Force Technical Applications Center, the aircraft is equipped with specialized sensors and sampling devices to detect radioactive particles and gases, enabling the U.S. to monitor nuclear detonations or radiological incidents worldwide. The WC-135R's capabilities include flying at altitudes up to 40,000 feet with a range exceeding 4,000 nautical miles, allowing it to conduct extended surveillance missions over diverse regions. Historically, the Constant Phoenix series has played a critical role in nuclear monitoring since the Cold War, including detecting Soviet nuclear
energynuclear-detectionairborne-surveillanceatmospheric-samplingmilitary-technologyradiological-monitoringnuclear-test-ban-treatyFujitsu to design Japan’s zetta-class supercomputer that’s 1000 times more powerful
Japanese technology company Fujitsu has been selected by the RIKEN research institute to design FugakuNext, Japan’s next-generation flagship supercomputer. Building on the success of Fugaku, which debuted in 2020 and achieved 442 petaFLOPS performance, FugakuNext aims to be a zetta-class supercomputer with performance approximately 1000 times greater than current systems. The project reflects Japan’s strategic focus on integrating AI with scientific simulations and real-time data, a concept known as “AI for Science,” to maintain leadership in science and innovation. The design phase, including the overall system, computer nodes, and CPU components, will continue until February 2026, with a total budget for the build expected to be around $750 million. Fujitsu will utilize its advanced CPUs, specifically the FUJITSU-MONAKA3 and its successor MONAKA-X, to power FugakuNext. These CPUs are engineered for high performance and energy efficiency and will enable the supercomputer
energysupercomputerFujitsuAIhigh-performance-computingCPUscientific-simulationsNew battery to power Chinese flying taxis with more speed, safety
Chinese battery manufacturer Gotion High-tech has partnered with eVTOL developer Ehang to equip Ehang’s flagship EH216 aerial vehicle with Gotion’s advanced 46-series cylindrical battery cells. This upgrade promises to enhance the EH216’s performance by providing longer range, stronger power output, and improved safety. The collaboration builds on a prior agreement from December 2023 and aims to accelerate the commercialization of low-altitude urban air mobility by improving battery technology tailored for short-range autonomous flights. Ehang, a pioneer in China’s eVTOL sector, has demonstrated significant progress with its EH216-S model, which currently offers a top speed of 80.8 mph and a flight duration of up to 25 minutes. Notably, Ehang tested a version with solid-state batteries that achieved a continuous flight of over 48 minutes, highlighting ongoing efforts to advance battery technology for aerial applications. Gotion, ranked as the sixth-largest global power battery manufacturer with a 3.4% market share,
energybattery-technologyeVTOLaerial-vehicleselectric-vertical-takeoff-and-landingenergy-storageurban-air-mobilityGeely Brings Electric EX5 to 6 Adriatic Countries - CleanTechnica
Geely Auto officially launched its electric SUV, the Geely EX5, across six Adriatic countries—Serbia, Croatia, Slovenia, Bosnia and Herzegovina, North Macedonia, and Montenegro—on June 10, 2025. The EX5 is notable for being Geely’s first global model to receive EU Whole Vehicle Type Approval (WVTA) certification, marking a significant step in the company’s global electrification strategy. The launch events in Serbia and Croatia attracted extensive media attention from regional automotive journalists, who praised the EX5’s advanced capabilities and technological innovations, anticipating that it will invigorate the regional electric vehicle market. Since entering the Serbian market in March 2023 through its regional partner SEEAG, Geely has introduced multiple models, including the Starray, Coolray, and EX5, catering to diverse customer preferences in design, performance, and sustainability. The brand has expanded its presence with 36 dealership outlets across the six countries, operating under a unified regional dealership model
energyelectric-vehiclesGeely-EX5automotive-technologyelectrificationsustainable-transportationnew-energy-vehiclesSenate Republicans Look Ready to Kill Clean Energy & EV Tax Credits — Shocker - CleanTechnica
The article from CleanTechnica highlights the ongoing political battle over clean energy and electric vehicle (EV) tax credits in the United States. It underscores that Republican politicians, historically funded by the fossil fuel industry, have consistently opposed legislation promoting clean energy, energy efficiency, and EV incentives despite growing evidence of environmental harm caused by fossil fuels. While Democrats enacted significant clean energy tax credits through the Inflation Reduction Act of 2022 when they controlled the federal government, the current Republican majority in the White House, House, and Senate is moving to repeal or drastically reduce these incentives. Recent developments indicate that the Senate Republicans are poised to phase out clean energy and energy efficiency tax credits, albeit at a slower pace than the House’s more aggressive budget bill. However, EV incentives face rapid and severe cuts. Critics, including the Natural Resources Defense Council and Senator Ron Wyden, warn that these actions will lead to higher energy prices, job losses in manufacturing, factory closures, and exacerbate the climate crisis. The article conveys
energyclean-energyelectric-vehiclesenergy-efficiencytax-creditsclimate-policyrenewable-energyWeak Aircraft Innovation Undercutting Aviation’s Green Transition - CleanTechnica
The article from CleanTechnica highlights concerns that the aviation industry's reliance on conventional fossil-fuel-powered aircraft and slow technological innovation are jeopardizing its decarbonization goals. Despite the Paris Air Show showcasing new aircraft, most are incremental updates of older models rather than breakthrough designs. A new analysis by Transport & Environment (T&E) reveals that if manufacturers accelerated innovation—particularly in zero-emission technologies such as hydrogen propulsion—European aviation could improve efficiency by up to 13-17% by 2050 compared to a business-as-usual scenario. This improvement could reduce cumulative CO₂ emissions by 123 million tonnes, equivalent to removing 62 million petrol and diesel cars from European roads for a year. The article emphasizes that innovation in aircraft design has stagnated over the past decade, with no new models expected in the next ten years. Airbus and Boeing, the dominant players, have delayed or paused the introduction of disruptive technologies, instead opting to update older airframes like the Airbus A320neo and
energyaviationgreen-transitiondecarbonizationaircraft-innovationrenewable-electricityhydrogen-aircraftState vs. Local Control Over Energy Siting Sparks Debate In Pennsylvania - CleanTechnica
The article discusses the longstanding controversy over who should control the siting of new electrical generating facilities, focusing on recent debates in Pennsylvania. Historically, energy siting decisions have been contentious due to the trade-offs between proximity to demand centers and local community impacts, especially with thermal plants and now renewable projects like solar farms and wind turbines. Local communities, particularly in rural areas, often oppose such developments due to concerns about aesthetics and quality of life, fueling political tensions between rural and urban interests. In Pennsylvania, lawmakers are considering establishing a state-level board called the Reliable Energy Siting and Electric Transition Board (RESET) to centralize authority over energy siting decisions, replacing the current patchwork of local regulations. Proponents argue that localities lack the expertise to handle complex, costly energy projects and that local opposition causes delays and increased costs. However, opponents fear the board could favor thermal generation projects, increasing carbon and methane emissions contrary to climate goals. Clean energy advocates emphasize the need to streamline approvals for renewable projects,
energyenergy-sitingrenewable-energypower-generationenergy-policysolar-farmswind-turbinesNewly-found sea spiders survive on methane-fed microbial coats
Scientists have discovered three new species of sea spiders (genus Sericosura) in the deep Pacific Ocean that survive by grazing on methane-eating microbes living on their translucent exoskeletons. Unlike typical sea spiders that hunt prey by piercing and sucking fluids, these spiders lack hunting tools and instead farm bacteria that convert methane leaking from the seafloor into sugars and fats. This symbiotic relationship allows the spiders to obtain nutrition directly from their microbial coats, effectively turning them into living ecosystems. This unique feeding strategy is the first of its kind observed in sea spiders and highlights a novel adaptation to the extreme, sunless environment of methane seeps. These tiny, nearly transparent spiders—about 1 centimeter long—are found in localized populations off the U.S. West Coast and Alaska. Their reproductive behavior is also unusual: females release hundreds of eggs from their kneecaps, which males carry in sac-like bundles on their limbs, passing methane-consuming bacteria to their offspring to ensure an immediate food source.
energymethanedeep-seamicrobial-symbiosiscarbon-cyclechemosynthesisclimate-changeAll-New 2026 Nissan LEAF Launches — Will Get LEAF to 1 Million Units Sold - CleanTechnica
The all-new 2026 Nissan LEAF marks a significant evolution of one of the electric vehicle (EV) pioneers, aiming to boost its cumulative sales from nearly 700,000 units toward the milestone of 1 million. Nissan has enhanced the LEAF with a sleek, modern design that positions it in the highly popular small SUV/crossover segment, which could drive increased consumer interest amid strong competition. Key updates include a new 3-in-1 powertrain integrating motor, inverter, and reducer, a 75-kWh liquid-cooled lithium-ion battery offering an estimated range of about 303 miles, and the adoption of the North American Charging Standard (NACS) with Plug & Charge functionality, enabling access to Tesla Superchargers in the U.S. Additional notable features for the 2026 LEAF include advanced technology such as dual 14.3-inch displays, Google built-in services, wireless Apple CarPlay and Android Auto, and premium options like a dimming panoramic roof, 3
energyelectric-vehicleslithium-ion-batteriesNissan-LEAFelectric-powertrainEV-chargingautomotive-technologyPower Anywhere: This Jackery Solar Generator Bundle Is Nearly 50% Off Right Now - CleanTechnica
The article highlights a significant discount on the Jackery Solar Generator 1000 v2 bundled with a 200W SolarSaga solar panel, currently available for nearly 50% off its usual $1,299 price. This portable power solution offers 1,070Wh capacity and 1,500W continuous output (3,000W surge), powered by a durable LiFePO₄ battery rated for over 4,000 charge cycles. It supports fast charging—about 1 hour from a wall outlet and roughly 3 hours from solar under ideal conditions—making it highly convenient for emergencies, outdoor activities, or off-grid use. The unit is compact (23.8 lbs), rugged, quiet, and manageable via a dedicated app. The bundle is ideal for campers, overlanders, remote workers, homeowners needing backup power during outages, and clean energy advocates seeking a gas-free, renewable power source. The article emphasizes the rarity of such a high-quality solar generator setup being offered below $
energysolar-powerportable-generatorLiFePO4-batteryrenewable-energyoff-grid-powerclean-technologyEVs dominate the most American-made cars index and it’s not just because of Tesla
The 2025 American-Made Index (AMI), compiled annually by Cars.com, highlights the dominance of electric vehicles (EVs) in the U.S. auto manufacturing landscape, with Tesla securing the top four positions. Tesla’s Model 3 was ranked as the most American-made vehicle, reflecting the company’s consistent presence in the top 10 since it began participating five years ago. Notably, EVs claimed six of the top 10 spots on the list, including models from Kia and Volkswagen, underscoring the significant shift toward electrification beyond Tesla alone. The index evaluates vehicles based on factors such as final assembly location, percentage of U.S. and Canadian parts, origin of engines and transmissions, and U.S. manufacturing workforce. Among the standout vehicles, the Kia EV6, assembled in Georgia, contains the highest percentage of U.S. and Canadian parts at 80%, the most of any vehicle sold in the U.S. today. This year’s index included 11 battery-electric
energyelectric-vehiclesEV-manufacturingAmerican-made-carsbattery-electric-vehiclesautomotive-industryvehicle-electrificationA comprehensive list of 2025 tech layoffs
The article provides a detailed overview of the ongoing wave of tech layoffs in 2025, highlighting the significant impact on the industry and workforce amid growing adoption of AI and automation. It tracks layoffs across numerous companies, noting monthly totals such as over 24,500 employees laid off in April and 10,397 in May. The piece underscores the human cost of these cutbacks while also suggesting potential implications for innovation in the tech sector. Several major companies are featured with specific layoff figures and contexts. Microsoft announced cuts exceeding 6,500 jobs, representing about 3% of its global workforce of 228,000, marking one of its largest layoffs since 2023. Amazon has reduced its workforce by approximately 27,000 since 2022, including around 100 layoffs in its devices and services division. Other notable layoffs include Chegg cutting 248 employees (22% of its staff) due to declining web traffic amid AI competition, CrowdStrike reducing about 500 roles as part of
robotIoTenergysemiconductorstech-layoffsworkforce-reductionautomationPro-Israel hacktivist group claims responsibility for alleged Iranian bank hack
The pro-Israel hacktivist group Predatory Sparrow (also known as Gonjeshke Darande) claimed responsibility for a cyberattack that allegedly targeted and disrupted Iran’s Bank Sepah. The group stated on social media platform X that they destroyed data belonging to Bank Sepah, which they accuse of helping the Islamic Revolutionary Guard Corps (IRGC) circumvent international sanctions and finance Iran’s ballistic missile, nuclear, and proxy activities. Reports from Iran International indicated widespread banking disruptions, including branch closures and customers being unable to access accounts, with images circulating of ATMs displaying error messages. However, TechCrunch was unable to independently verify the attack, and Bank Sepah and its affiliates did not respond to requests for comment. This alleged cyberattack occurs amid escalating hostilities between Israel and Iran, following Israeli strikes on Iranian nuclear and military sites. Predatory Sparrow is believed to be a pro-Israel or anti-Iran hacktivist group with a history of targeting Iranian infrastructure, including steel plants
energycybersecuritycyberattackhacktivistIrannuclear-energyindustrial-disruptionEurope Risks Losing Its Early E-Fuels Lead for Aviation, Study Warns - CleanTechnica
A new study by Transport & Environment (T&E) highlights Europe’s potential to lead in the production of e-kerosene (also known as e-SAF), a scalable sustainable aviation fuel capable of reducing CO₂ emissions by over 90% compared to fossil kerosene. Europe currently hosts more than half of the world’s announced e-kerosene production capacity, with around 40 large-scale projects planned that could produce nearly 3 million tonnes annually—about 5% of Europe’s aviation fuel needs. This early lead has been driven by the EU’s ReFuelEU law, which sets targets for sustainable aviation fuel use. However, despite these announcements, none of the large-scale plants are under construction, only four projects are at an advanced stage, and none have reached final investment decisions (FID). The slow progress is largely due to financing challenges and the notable absence of traditional fuel suppliers from the market. The study warns that without increased investment and a stable legal framework, Europe risks
energysustainable-aviation-fuele-fuelse-keroseneaviation-decarbonizationrenewable-energyEU-energy-policyAre Refreshed Models Enough To Stabilize The Tesla Brand? - CleanTechnica
The article discusses Tesla's recent 2025 refreshes of its Models S, X, and Y, highlighting the updates as a positive development amid ongoing controversies surrounding CEO Elon Musk. The refreshed Model Y, the world’s bestselling car in 2023 and 2024, features a more futuristic design, improved aerodynamics, quieter cabin, softer suspension, and enhanced range efficiency. The Models S and X also received aerodynamic improvements, noise cancellation, and aesthetic updates, with prices starting at $84,990 and $89,990 respectively. Tesla aims to address consumer concerns such as range anxiety with the Model S Long Range offering up to 410 miles per charge, along with increased space for passengers and cargo. Despite these product enhancements, the article questions whether refreshed models alone can stabilize Tesla’s brand and regain consumer and shareholder confidence. Musk’s controversial political statements and erratic behavior have alienated some loyal customers and investors, contributing to a loss of trust. Critics note that Tesla’s vehicle lineup is aging
energyelectric-vehiclesTeslaautomotive-technologybattery-rangevehicle-aerodynamicssuspension-systemPro-Israel hacktivist group claims reponsibility for alleged Iranian bank hack
The pro-Israel hacktivist group Predatory Sparrow, also known by its Persian name Gonjeshke Darande, claimed responsibility for a cyberattack that allegedly targeted and disrupted Iran’s Bank Sepah. The group stated that their attack destroyed data belonging to Bank Sepah, which they accused of helping the Islamic Revolutionary Guard Corps (IRGC) circumvent international sanctions and finance Iran’s terrorist proxies, ballistic missile program, and military nuclear efforts. Following the claim, reports emerged of widespread banking disruptions in Iran, including closed Bank Sepah branches and customers being unable to access their accounts, with ATMs reportedly displaying error messages. However, independent verification of the cyberattack remains unavailable, and attempts to contact Bank Sepah and Predatory Sparrow for confirmation were unsuccessful. This alleged cyberattack occurs amid escalating hostilities between Israel and Iran, with both countries reportedly conducting strikes against each other’s military and nuclear infrastructure. While the exact identity of Predatory Sparrow remains unclear, cybersecurity experts consider the group credible based
energycybersecuritycyberattacknuclear-energyindustrial-disruptionhacktivismIranEurope: World's largest sand battery goes live, cuts 70% CO2 emissions
The world’s largest industrial-scale sand battery has become fully operational in Pornainen, Finland, developed by startup Polar Night Energy for the local district heating company Loviisan Lämpö. This innovative thermal energy storage system uses 2,000 tons of crushed soapstone to store surplus renewable electricity as heat, delivering one megawatt of thermal power with a 100 megawatt-hour capacity. The sand battery can cover nearly a month’s heating demand in summer and up to a week in winter, supplying heat to municipal buildings and homes while significantly reducing reliance on fossil fuels. The installation is expected to cut Pornainen’s district heating CO2 emissions by nearly 70%, equivalent to about 160 tons annually, by eliminating oil use and reducing wood chip consumption by 60%. A biomass boiler remains as backup for peak demand periods. Beyond heat storage, the sand battery supports grid balancing by optimizing energy use based on electricity prices and reserve markets managed by Finland’s grid operator Fingrid, with digital services provided
energyrenewable-energythermal-energy-storagesand-batterydistrict-heatingclean-energyenergy-transitionHaven Energy & Clean Energy Alliance Launch Free Battery Storage Program For Eligible California Homeowners - CleanTechnica
Haven Energy and the Clean Energy Alliance (CEA) have launched the Battery Bonus Connect program, offering free home battery storage systems to income-eligible homeowners in San Diego County, including cities like Carlsbad, Del Mar, and Solana Beach. Funded by California’s Self-Generation Incentive Program, the initiative targets homeowners who participate in CEA’s PeakSmart Savers virtual power plant program and meet income criteria (generally 80% or less of area median income or enrollment in assistance programs). The program covers full installation, ten years of maintenance, and support with no upfront costs, credit checks, or long-term contracts. After ten years, homeowners can keep the system at no cost or purchase it at fair market value. The installed batteries will be integrated into a virtual power plant managed by Haven Energy, which uses stored energy during peak grid demand to ease grid pressure while reserving at least 20% capacity for homeowners’ personal use. This approach enhances energy reliability, reduces reliance on
energybattery-storageclean-energyvirtual-power-plantrenewable-energyenergy-resiliencehome-energy-systemsTiny French EV tilts like bike, hits 71 mph, runs 124 miles per charge
AEMotion, a French e-mobility company, has introduced a compact electric microcar that uniquely combines motorcycle-like agility with the safety of a four-wheeled vehicle. This innovative EV features a tilting mechanism allowing the entire frame to lean up to 35 degrees in curves, enhancing dynamic handling. It is steered via handlebars and seats the driver and passenger in a tandem arrangement, reducing the vehicle’s width to just 31 inches (79 cm), ideal for navigating narrow urban streets. The microcar reaches a top speed of 71.5 mph (115 km/h) and offers a fixed battery range of 124 miles (200 km), with optional swappable battery packs providing an additional 43.5 miles (70 km) each. Safety is a key focus, with the vehicle meeting automotive-grade crash standards through the use of EPP bumpers, crash boxes, and an EPP-lined interior that acts like a passive airbag system. It also includes hydraulic disc brakes and
energyelectric-vehiclebattery-technologyurban-mobilitysafety-materialstilting-technologye-mobilitySenate GOP bill spares nuclear and geothermal energy while hammering wind and solar
Senate Republicans have introduced a budget reconciliation bill that significantly scales back renewable energy incentives established under the Inflation Reduction Act (IRA), particularly targeting solar, wind, and hydrogen energy. The bill proposes ending residential solar tax credits within 180 days of enactment and disqualifying solar leasing companies from receiving credits, which would severely impact the residential solar market. Commercial wind and solar projects would face a shortened timeline for tax credits, with full credits only available for projects starting within six months of the bill’s signing and phased reductions thereafter, disappearing entirely after 2027. Hydrogen tax credits would also end this year, creating additional challenges for hydrogen startups. In contrast, the bill largely spares geothermal, nuclear, hydropower, and long-duration energy storage technologies, with only slight extensions to their tax credit phase-outs. Carbon capture incentives would be modified to eliminate distinctions based on the use of captured carbon, making all projects eligible for the same credit level. Notably, the inclusion of long-duration energy storage could
energyrenewable-energysolar-powerwind-energynuclear-energygeothermal-energyenergy-policyA New Hope For EV Sales In The US: The Super Mustang Mach-E
The article discusses the evolving landscape of electric vehicle (EV) sales in the US amid shifting political and regulatory environments. Despite setbacks following the Trump administration’s anti-EV stance, US automakers like Ford continue to pursue electrification both domestically and internationally. Ford, leveraging its iconic brand heritage and motorsports experience, has found ways to maintain and grow its EV market share by focusing on electrified versions of popular models and entering niches less dominated by Tesla. A key highlight is Ford Performance’s unveiling of the Super Mustang Mach-E, a three-motor EV demonstrator designed for the demanding Pikes Peak International Hill Climb. Developed in partnership with STARD Advanced Research and Development, this vehicle showcases significant advancements over Ford’s previous EV race entry, including improved regenerative braking, weight reduction, and enhanced maneuverability. The Super Mustang Mach-E features a 50 kWh Li-polymer NMC pouch cell battery operating at 799V, delivering 710 kW of regenerative braking power while shedding over
energyelectric-vehiclesEV-salesFord-Mustang-Mach-Eelectric-motorsportsregenerative-brakingvehicle-electrificationUS lab uses nano-CT scans to breathe new life into dead EV batteries
Researchers at the US National Renewable Energy Laboratory (NREL) are employing ultra-high-resolution nano-computed tomography (nano-CT) scans to analyze and revive spent lithium-ion batteries from electric vehicles (EVs). This nondestructive imaging technique, capable of resolving features down to 50 nanometers, reveals microscopic cracks and internal defects in battery cathodes that traditional methods miss. These cracks, particularly in nickel-rich cathode particles, impede lithium-ion flow and degrade fast-charging capabilities despite retained energy capacity. By correlating structural damage with performance loss, the team can identify specific degradation patterns and tailor direct-recycling methods that refurbish rather than fully rebuild cathodes. The direct-recycling approach aims to repair damaged cathodes through gentler mechanical treatments that restore cracked particles or replace only damaged sections, preserving the crystal structure critical for high energy density. This method contrasts with conventional recycling, which dissolves electrodes into basic chemicals—an energy-intensive process that also risks losing valuable metals. Successful implementation would reduce processing
energylithium-ion-batteriesbattery-recyclingnano-CT-imagingelectric-vehiclesbattery-materialsNational-Renewable-Energy-LaboratoryHonda dips its toes in cargo delivery micromobility
Honda is entering the cargo delivery micromobility market with its new Fastport eQuad, a battery-assisted four-wheeled vehicle designed for urban delivery use. The eQuad comes in two sizes, both smaller than a Mini Cooper but capable of carrying between 320 to 650 pounds. It features pedals and a top speed limited to 12 mph (20 kph) to comply with bike lane regulations. The vehicle uses Honda’s swappable Mobile Power Pack batteries, enabling quick battery changes to maintain continuous operation. Inside, the eQuad offers a bike-like cockpit with a seat, pedals, windscreen, and a display to assist navigation. Honda emphasizes the eQuad as a software-defined vehicle, suggesting ongoing value and improvements through software updates, although specific features were not detailed. Production of the U.S.-bound eQuads will take place at Honda’s Performance Manufacturing Center in Ohio, a facility previously known for assembling high-performance supercars. This move marks a shift for Honda into the growing
energyelectric-vehiclesmicromobilitybattery-technologycargo-deliveryHondasustainable-transportationMcLaren unveils 662-horsepower hypercar model for 2027 Le Mans
McLaren has unveiled a 662-horsepower hypercar prototype set to compete in the 2027 24 Hours of Le Mans, marking the British automaker’s return to the iconic race 30 years after its dominant 1995 victory with the McLaren F1 GTR. The new car will race in the LMDh class, competing against manufacturers like Cadillac and BMW, and will feature a carbon-fiber monocoque chassis supplied by Dallara, shared with other LMDh competitors. Power will come from a hybrid-assisted twin-turbo V6 engine, capped at 662 hp in accordance with class regulations, though detailed specifications remain undisclosed. In addition to its racing ambitions, McLaren is launching Project: Endurance, an exclusive program allowing customers to purchase a road-legal version of the hypercar with minimal modifications from the race car. Buyers will gain access to a two-year track experience at premier circuits and behind-the-scenes involvement in the car’s development leading up
energyhybrid-technologyautomotive-materialscarbon-fiber-chassismotorsport-engineeringLe-Mans-hypercarMcLarenThe Moment to Make Automotive Steel More Circular Is Now - CleanTechnica
The article from CleanTechnica highlights the urgent need for the European Union to enhance circularity in automotive steel production. Despite the automotive sector being the EU’s second-largest steel consumer, only 6% of the steel used in cars comes from recycled scrap, far below the 56% average across all sectors. This low recycling rate is primarily due to contamination—especially copper from parts like wire harnesses—that occurs when old vehicles are shredded, rendering the steel unsuitable for reuse in new cars. The upcoming revision of the EU’s End-of-Life Vehicles (ELV) Regulation presents a critical opportunity to address this issue by introducing mandatory recycled steel content targets and quality standards. To unlock a market for higher-quality recycled steel, the article argues that EU policymakers should set a target of 30% recycled steel content in new cars by 2030, coupled with local content requirements to support European recyclers and reduce reliance on imported raw materials. Additionally, quality standards must be established to limit copper contamination in shredded scrap
energymaterialsautomotive-steelrecyclingcircular-economyEU-policysustainable-manufacturingEVS38 Is All About Charging - CleanTechnica
The Electric Vehicle Symposium (EVS38) held in Gothenburg is entirely focused on charging technology, infrastructure, policies, and future developments related to electric mobility. As the largest and most significant scientific conference on the electric vehicle transition, it attracted over 400 abstract submissions, all addressing various aspects of charging. The event also features an exhibition showcasing numerous high-power DC chargers and related industry support. While many presentations are highly technical and challenging for non-specialists, the main stage offers more accessible content. The author plans to review selected presentations in the coming week and participate in excursions to the Volvo tech center and an MCS charging hub. Additional detailed analyses and summaries of EVS38 will be provided through CleanTechnica’s channels.
energyelectric-vehiclescharging-technologyelectric-mobilitycharging-infrastructureDC-chargerssustainable-energyTrump urges Tehran evacuation as G7 warns: No nukes for Iran
At the G7 summit held in Kananaskis, Canada, amid escalating conflict between Israel and Iran, the leaders of the G7 nations issued a strong joint statement asserting that Iran must never be allowed to acquire nuclear weapons. They reaffirmed Israel’s right to self-defense and expressed concern over the broader impact of the Middle East crisis on global energy markets, pledging to coordinate efforts to maintain market stability. However, the summit was overshadowed by the intensifying violence, prompting U.S. President Donald Trump to cut his attendance short and call for the immediate evacuation of Tehran. Trump’s early departure was accompanied by reports that he proposed a ceasefire plan between Israel and Iran, aiming to initiate broader peace discussions. French President Emmanuel Macron described Trump’s exit as a potentially positive step toward direct talks, though a U.S. official noted Trump would not endorse a joint G7 statement calling for de-escalation. Meanwhile, fighting intensified with Iranian air defenses activated in Tehran and Natanz, and Israeli
energynuclear-weaponsMiddle-East-conflictG7-summitIranIsraelglobal-energy-marketsA Deeper Look at Hidden Damage: Nano-CT Imaging Maps Internal Battery Degradation - CleanTechnica
The article discusses advances in understanding and improving lithium-ion battery recycling through high-resolution nano-CT imaging, led by researchers at the National Renewable Energy Laboratory (NREL). Lithium-ion batteries rely on scarce and valuable minerals such as lithium, nickel, cobalt, manganese, and graphite, with much of the global supply chain controlled by China. To reduce dependence on foreign markets and extend the lifespan of critical materials, direct recycling of battery cathodes within the United States is being explored as a more efficient and cost-effective alternative to traditional recycling methods, which are energy-intensive and break materials down to their elemental forms. NREL’s nano-CT scanner, capable of 50-nanometer spatial resolution, allows nondestructive, real-time visualization of internal battery structures, revealing microscopic degradation that impacts battery performance. Researchers found that although end-of-life battery materials retained similar energy capacity to new cells, their charging rates were significantly reduced due to morphological damage—specifically, particle cracking within the cathode microstructure. This insight
energybattery-technologylithium-ion-batteriesnano-CT-imagingmaterials-sciencebattery-recyclingenergy-storageDongfeng-Nissan Bets on a China-First Strategy with the N7 Sedan - CleanTechnica
The Dongfeng-Nissan N7 electric sedan, launched officially at the Shanghai Motor Show in April 2025 after its initial presentation in November 2024, represents a strategic shift for Nissan focused on the China market. Manufactured entirely in China by Dongfeng, the N7 combines Nissan’s engineering and design philosophy with local market insights, resulting in a vehicle tailored specifically for Chinese consumers. Since its launch, the N7 has rapidly gained traction, selling over 20,000 units within two months, with daily sales increasing by about 100 cars in major Chinese cities including Shanghai, Beijing, Nanjing, and Wuhan. The N7 is built on Nissan’s new dedicated electric platform and emphasizes aerodynamic efficiency with a low drag coefficient of 0.208. Its design features include frameless doors, flush handles, and advanced customizable LED lighting with 710 LEDs in the headlights and 882 OLEDs in the rear light bar. Inside, the minimalist cabin centers around a 15.6-inch
energyelectric-vehicleDongfeng-Nissanautomotive-technologyelectric-sedanLED-lightingAI-systemThe "EVs Are Big Polluters" Circus Is Back In Town - CleanTechnica
The article from CleanTechnica addresses renewed criticism of electric vehicles (EVs), sparked by comments from Akio Toyoda, president of Toyota, who argued that in Japan—where electricity generation relies heavily on thermal power plants—producing EVs could increase carbon emissions compared to hybrids. This statement was seized upon by anti-EV groups to claim that EVs are worse polluters than hybrids or gasoline cars. However, the article highlights that such claims often stem from misinformation or ideological bias against EVs and fail to consider the full lifecycle emissions of vehicles. Scientific studies, including one published by IOP Science, acknowledge that EV manufacturing produces higher initial carbon emissions due to battery production, creating a "carbon debt." Yet, over their operational lifetime, EVs offset this debt by producing significantly lower emissions during use, especially as electricity grids become cleaner. The breakeven point for EVs to become cleaner than hybrids is typically between 20,000 and 30,000 miles, and even shorter when
energyelectric-vehiclescarbon-emissionsbattery-manufacturingrenewable-energypower-gridsustainabilityHere Comes the Infinity Train - CleanTechnica
The article announces the arrival of the long-anticipated Infinity Train, also known as the Gravity locomotive, in the Pilbara region of Western Australia. This innovative battery electric locomotive, converted from a 1998 GE 9-44CW unit, is designed to transport iron ore to the coast for shipment to China while significantly reducing diesel fuel consumption and carbon emissions. The train leverages gravitational energy by generating electricity when traveling downhill loaded with ore, which recharges its batteries to power the return trip empty—effectively enabling regenerative braking on a large scale and eliminating the need for additional charging or diesel fuel. The Infinity Train is part of Fortescue Metals Group’s broader strategy to achieve net zero emissions by 2030 and to pioneer green industrial transport technology. Fortescue founder Andrew "Twiggy" Forrest, a mining magnate turned renewable energy advocate, emphasizes that the project exemplifies a shift away from fossil fuels toward more efficient, lower-cost, and environmentally friendly energy sources like gravitational energy. The
energyrenewable-energybattery-electric-locomotivegreen-technologyregenerative-brakingnet-zero-emissionsindustrial-transportCatalyst mimics photosynthesis to turn CO2 into clean industrial fuel
Researchers at Brookhaven National Laboratory have developed a novel catalyst inspired by photosynthesis that converts carbon dioxide (CO2) into formate, a valuable industrial chemical, using only light, protons, and electrons. This ruthenium-based catalyst mimics the natural process of photosynthesis by storing solar energy in chemical bonds through proton and electron transfers triggered by light. The innovation addresses the urgent need to reduce atmospheric CO2 by not only capturing it but also transforming it into useful compounds for fuels, pharmaceuticals, and antimicrobial products. The team redesigned the catalyst’s structure by surrounding the metal center with ligand “petals,” shifting the chemical activity from the metal to the ligands. This approach prevents CO2 from binding directly to the metal, which traditionally leads to side reactions and catalyst degradation. As a result, the process selectively produces formate without generating competing byproducts like hydrogen or carbon monoxide. Additionally, this ligand-based mechanism allows for flexibility in the choice of the central metal; while ruthenium was used
energycatalystphotosynthesiscarbon-captureCO2-conversionrenewable-energychemical-synthesisFinland warms up the world’s largest sand battery, and the economics look appealing
Finland has recently activated the world’s largest sand-based thermal energy storage system, located in the town of Pornainen. This “sand battery” stores heat by using electricity—primarily from renewable sources—to warm 2,000 metric tons of pulverized soapstone contained within an insulated silo. The stored heat, which can reach temperatures up to 400 degrees Celsius, is used to supply the town’s district heating network, significantly reducing reliance on oil and wood chips. The system can store 1,000 megawatt-hours of heat for weeks, covering about a week’s heating needs during the Finnish winter, with only 10-15% heat loss during storage and recovery. The economics of the sand battery are attractive due to the low cost of raw materials—soapstone discarded from a fireplace manufacturer—and the relatively simple infrastructure. The battery allows the town to draw electricity when prices are lowest, benefiting from Finland’s clean and affordable grid, which is powered 43% by renewables and
energythermal-energy-storagesand-batteryrenewable-energydistrict-heatingcarbon-emissions-reductionFinland-energy-innovationHelium & Hot Air: Saskatchewan’s Greenwashing Sustainability Claims - CleanTechnica
The article critiques Saskatchewan’s government for promoting misleading sustainability claims, particularly highlighting an ad campaign that touts the province as a leader in environmental stewardship. A key example is the province’s helium production being equated to planting billions of trees. While Saskatchewan’s helium extraction produces relatively low greenhouse gas emissions compared to global standards—due to a unique geological occurrence where helium is found alongside nitrogen rather than methane—this advantage is a matter of geological luck rather than deliberate environmental policy. The province is essentially marketing this natural quirk as a conscious sustainability achievement, despite continuing significant emissions from oil and gas extraction, which accounts for about 30% of its greenhouse gases. The article further contextualizes Saskatchewan’s overall environmental impact, noting that it remains one of Canada’s highest per-capita emitters of greenhouse gases, with roughly 74 million tons of CO2 equivalent emitted in 2023—about six times the per-capita emissions of Ontario or Quebec. Besides oil and gas, major emission sources include coal and natural
energyhelium-extractionsustainabilitygreenhouse-gas-emissionsmethane-emissionsnatural-gasenvironmental-policyThe Unbelievably Big Bad Bill Hurts IRA Incentives And Red States - CleanTechnica
The article discusses the significant negative impact of the proposed "One BIG Beautiful Bill Act" (OBBBA) on the clean energy incentives established by the Biden administration’s Inflation Reduction Act (IRA). The OBBBA, supported by former President Trump and the House Ways and Means Committee, aims to end tax credits for cleaner vehicles by 2025 and gradually eliminate incentives for wind, solar, and nuclear energy projects by 2032. This rollback threatens to derail the rapid growth of clean energy in the U.S., which saw a 47% increase in capacity in 2024, with solar and battery technologies leading the expansion. The article highlights that clean energy investments have created over 240,000 manufacturing jobs, with 78% of spending benefiting Republican-held suburban and rural districts. The rollback is linked to the Trump administration’s preferential treatment of oil and gas exploration and its suspension of clean energy development on federal lands. Since January, businesses have canceled or delayed more than $20 billion in clean energy
energyclean-energyrenewable-energyelectric-vehiclessolar-powerbattery-manufacturingenergy-policyDirect Air Carbon Capture Is Scaling Up, With Mineralization
The article discusses the evolving landscape of carbon capture technologies, with a particular focus on direct air capture (DAC) and mineralization as promising approaches for long-term carbon sequestration. While federal support for carbon capture in the US is declining—highlighted by the Department of Energy’s recent cancellation of a $3.7 billion decarbonization demonstration program—global efforts continue to advance. The article contrasts various carbon capture methods, noting that biofuels and electrofuels recirculate carbon but depend heavily on supportive public policies. More durable sequestration options include reforestation and reforming captured carbon into solid products, such as incorporating it into cement. Mineralization emerges as a key solution for sustainable, long-term carbon storage by chemically locking carbon dioxide into stable carbonate minerals through reactions with reactive igneous or metamorphic rocks. This method offers advantages over traditional underground sequestration in porous sedimentary rock, where carbon can potentially escape. The US Geological Survey estimates significant underground sequestration capacity, but
energycarbon-capturedirect-air-capturemineralizationdecarbonizationcarbon-sequestrationsustainable-technologyChina makes Yttrium-90 radioisotope in commercial nuclear reactor
China has successfully produced Yttrium-90 (Y-90) radioisotope using a commercial heavy-water nuclear reactor at the Qinshan Nuclear Power Plant in Zhejiang province. This marks the first time China has domestically manufactured Y-90 glass microspheres at scale, a significant advancement in the country’s isotope production capabilities. The China National Nuclear Corporation (CNNC) confirmed that the first batch of Y-90 microspheres met all quality standards, enabling large-scale, continuous production. Previously, China relied entirely on imports for this critical isotope used in cancer therapy, presenting challenges for patients. Yttrium-90 microspheres are a key component in transarterial radioembolization (TARE), a minimally invasive treatment for mid-to-late stage liver cancer. The microspheres deliver targeted beta radiation directly to liver tumors via the hepatic artery, destroying cancer cells while sparing surrounding healthy tissue due to their limited radiation penetration. The Qinshan team, collaborating with multiple research groups, leveraged the
energynuclear-energyradioisotopesyttrium-90cancer-treatmentnuclear-medicineisotope-productionBladeless wind turbines get upgrade with new design for quiet power
Researchers at the University of Glasgow have advanced the design of bladeless wind turbines (BWTs) through computer simulations that identify the most efficient configurations for future models. Unlike conventional turbines that use rotating blades, BWTs harness vortex-induced vibrations (VIV) by oscillating a tall, slender mast in the wind. This novel approach offers several advantages: BWTs are quieter, occupy less space, require less maintenance due to their simpler structure, and pose less risk to birds, which often collide with fast-spinning blades of traditional turbines. The study pinpointed an optimal design featuring an 80-centimeter tall mast with a 65-centimeter diameter, capable of safely generating up to 460 watts of power—significantly outperforming current prototypes that produce around 100 watts. This design balances power output with structural integrity, ensuring safety in wind speeds ranging from 20 to 70 miles per hour. The researchers suggest that their methodology could enable scaling BWTs to produce 1 kil
energywind-turbinesbladeless-technologyrenewable-energypower-generationvortex-induced-vibrationsustainable-energyA comprehensive list of 2025 tech layoffs
The article provides a detailed overview of the ongoing wave of tech layoffs in 2025, highlighting the significant impact on the industry and workforce amid increasing adoption of AI and automation. It tracks layoffs across numerous companies, noting that tens of thousands of employees have been laid off each month so far this year: over 24,500 in April, 16,234 in February, and 10,397 in May, among others. The article emphasizes the human cost of these cutbacks while acknowledging that innovation continues to drive structural changes in the sector. Specific company layoffs are detailed, including major reductions at Microsoft, which announced over 6,500 job cuts in May and additional layoffs affecting software engineers, product managers, and other roles in June. Amazon has reduced its workforce by approximately 27,000 since 2022, recently cutting around 100 employees from its devices and services division. Other notable layoffs include Chegg cutting about 22% of its staff due to declining web traffic amid AI competition,
robotIoTenergylayoffstech-industryautomationAIworkforce-reductionInductive Charging Experiment In Germany - CleanTechnica
The article discusses an innovative inductive charging experiment underway in Bavaria, Germany, led by Friedrich Alexander Universität Erlangen Nürnberg (FAU) and partners including the Federal Autobahn and Israeli company Electreon. The project involves embedding copper coils beneath a one-kilometer stretch of the A6 highway near Nuremberg to wirelessly charge specially equipped electric vehicles as they drive or stop over the coils. This dynamic inductive charging system, similar in principle to wireless phone charging, aims to reduce reliance on large, expensive batteries and alleviate range anxiety by providing continuous power on the road with over 90% efficiency. Scheduled to begin testing in the second half of 2025, the E|MPOWER project seeks to evaluate both the technical performance and economic feasibility of integrating inductive charging into heavy goods transport infrastructure. Key goals include optimizing coil manufacturing and installation methods to lower costs and installation times. Bavarian officials and FAU leadership emphasize the potential of this technology to revolutionize e-mobility by enabling seamless
energyinductive-chargingelectric-vehicleswireless-power-transfere-mobilityelectric-road-systemtransportation-technologyUS hypersonic aircraft to soar at Mach 5+ with new upgraded engines
The U.S. aerospace company Ursa Major has secured a $32.9 million contract to supply 16 upgraded Hadley H13 rocket engines for Stratolaunch’s Talon-A hypersonic test vehicle over several years. These new engines are designed to be more reusable, supporting more flight starts and thus reducing the cost per test. The H13 engine is an evolution of the existing Hadley engine, featuring advanced metals and an oxygen-rich staged combustion cycle that provides higher thrust (5,000 lbf) and longer operational lifespans. This upgrade aims to enhance Talon-A’s performance and durability, facilitating more frequent and cost-effective hypersonic flight tests. Talon-A is a reusable hypersonic vehicle capable of flying at speeds exceeding Mach 5 and is air-launched from Stratolaunch’s large carrier aircraft. It serves as a Pentagon test platform for military hypersonic technologies and recently completed its second successful Mach 5+ flight test in May 2025. The
energyaerospacehypersonic-technologyrocket-enginespropulsion-systemsreusable-enginesmilitary-technologyA New Obesity Pill May Burn Fat Without Suppressing Appetite
A new experimental obesity pill called SANA, developed by Eolo Pharma, shows promise in promoting weight loss by a novel mechanism that burns fat through creatine-dependent thermogenesis rather than suppressing appetite. Unlike popular drugs such as Ozempic and Wegovy, which reduce food intake by enhancing feelings of fullness and slowing gastric emptying, SANA activates a pathway in fat cells that generates heat and energy by breaking down creatine. This approach led to statistically significant weight loss of about 3 percent in obese participants over two weeks, comparable to the effects of GLP-1 drugs, but without reported decreases in appetite or satiety. The Phase I trial involved healthy-weight and obese participants who received varying doses of SANA or placebo. The drug was safe and well-tolerated with no serious side effects. Participants remained on high-carbohydrate diets during the study, yet those on the highest dose of SANA lost weight while maintaining appetite. Preclinical studies in mice showed that SANA not only
energythermogenesisobesity-treatmentcreatinemetabolismpharmaceutical-innovationweight-loss-drugIran claims it confused Israel’s defenses in Monday’s missile strike
On Monday, Iran launched a significant missile strike targeting Israeli cities including Tel Aviv and Haifa, resulting in the destruction of residential buildings, damage to infrastructure such as a power plant near Haifa’s port, and casualties with at least five dead and over 100 wounded. The attacks were reportedly in retaliation for Israel’s earlier airstrikes on Iranian nuclear and ballistic missile facilities, which killed key Iranian military leaders and caused substantial damage. Iran’s Revolutionary Guard claimed to have employed a “new method” that confused Israel’s missile defense systems into targeting each other, achieving successful hits despite Israel’s advanced technology. Israel has not officially commented on the missile strikes but has previously acknowledged vulnerabilities in its defense systems. The conflict has escalated rapidly, with Israel continuing to target Iranian military and Revolutionary Guard command centers, resulting in heavy Iranian casualties—over 220 killed and more than 1,200 injured, mostly civilians according to Iranian sources. Iran has vowed major retaliation, warning of opening “the gates of hell.”
energymissile-defensemilitary-technologyhypersonic-missilespower-plantregional-conflictdefense-systemsLarge-Scale V2G Systems Coming To Utrecht & Sweden - CleanTechnica
The article discusses the implementation and challenges of large-scale vehicle-to-grid (V2G) systems, focusing on recent developments in Utrecht, Netherlands, and plans in Sweden. V2G technology enables electric vehicles (EVs) to both draw electricity from and feed electricity back into the grid, effectively turning EV batteries into distributed energy storage. This system can help balance renewable energy supply fluctuations without utilities needing to install dedicated grid-scale batteries, while EV owners receive compensation. However, managing V2G is complex due to the need for coordination among diverse stakeholders—drivers, renewable energy suppliers, charging networks, and utilities—and the variability in EV models, battery management systems, and renewable energy availability. Utrecht has become Europe’s first city to implement a large-scale V2G system, called “Utrecht Energized,” through a collaboration involving Renault Group, We Drive Solar, and the carsharing service MyWheels. The initiative has installed 50 bidirectional chargers and integrated 50 Renault 5 E-Tech
energyvehicle-to-gridelectric-vehiclesrenewable-energysmart-gridbidirectional-chargingbattery-storageAgrivoltaics And The Underdogs Of The Natural World
The article discusses the emerging field of agrivoltaics, which combines solar energy production with agriculture and biodiversity conservation. Highlighted alongside Ryan Reynolds’ new National Geographic series "Underdogs," which showcases lesser-known species, agrivoltaics is presented as a promising solution to the global biodiversity crisis. Unlike traditional utility-scale solar farms that often clear land and reduce habitat quality, agrivoltaics integrates solar panels with crops, pollinator habitats, and other natural elements, thereby preserving productive farmland and supporting ecosystems. Farmers benefit from reliable income through leasing land for solar projects, while developers gain community support by emphasizing environmental benefits. The article also highlights innovative applications of agrivoltaics, including urban farming initiatives and anti-desertification projects. For example, large-scale solar arrays in China’s Kubuqi Desert aim to halt desert expansion by fostering micro-ecosystems beneath solar panels. Additionally, agrivoltaics supports diverse agricultural practices such as mobile farming and community gardens, enhancing food production in urban and
energyagrivoltaicssolar-energybiodiversitysustainable-agriculturerenewable-energyenvironmental-conservationLow-cost green hydrogen production possible with new breakthrough
Researchers at Hanyang University ERICA campus in South Korea have developed a new class of cobalt phosphide-based nanomaterials that significantly lower the cost of green hydrogen production. By adjusting boron doping and phosphorus content through metal-organic frameworks (MOFs), the team created catalysts with superior performance and affordability compared to conventional electrocatalysts. These materials exhibit large surface areas and mesoporous structures, enhancing their electrocatalytic activity for oxygen evolution reaction (OER) and hydrogen evolution reaction (HER). The best-performing sample demonstrated notably low overpotentials of 248 mV for OER and 95 mV for HER, outperforming previously reported catalysts. The innovative synthesis involved growing cobalt-based MOFs on nickel foam, followed by boron doping via sodium borohydride treatment and phosphorization with sodium hypophosphite. Density functional theory (DFT) calculations confirmed that the combination of boron doping and optimized phosphorus content improved interactions with reaction intermediates, driving the enhanced
energygreen-hydrogencatalystsnanomaterialsmetal-organic-frameworkselectrocatalysissustainable-energyBattery Ferries: Helios, China Zorrilla, & BC Ferries Compared - CleanTechnica
The article discusses three significant battery-electric ferry projects that highlight the rapid transformation of maritime travel through electrification. Viking Line’s Helios, expected in the early 2030s, is a fully electric ferry designed to operate on an 80-kilometer route between Helsinki and Tallinn, carrying 2,000 passengers, 650 cars, and substantial cargo entirely on battery power. Another pioneering vessel, the China Zorrilla, a high-speed electric catamaran built by Tasmania’s Incat for Buquebus, will serve the shorter Buenos Aires–Colonia del Sacramento route, covering about 93 kilometers. Both projects exemplify advances in battery-electric ferry technology aimed at reducing emissions and improving sustainability in maritime transport. In British Columbia, Canada, BC Ferries has contracted China Merchants Industry Weihai Shipyard to build four hybrid-electric ferries to replace its aging C-class vessels. These ferries, designed as diesel-battery hybrids with plans to transition to full electric as shore charging infrastructure
energyelectric-ferrybattery-propulsionmaritime-electrificationhybrid-electric-ferriesclean-transportationsustainable-energyA Primer About Wind On Global Wind Day - CleanTechnica
Global Wind Day, observed annually on June 15, aims to raise awareness about wind energy’s role as a clean, renewable, and sustainable power source. Wind is generated by the uneven heating of the Earth’s surface by the sun, causing air to move from high to low pressure areas, creating wind. This natural phenomenon has powered human activity for millennia, from ancient Egyptian sailboats to modern wind turbines that convert kinetic energy into electricity without greenhouse gas emissions, thus supporting the global transition to net-zero carbon emissions. Wind turbines, typically three-bladed and mounted on horizontal axes, vary in size and capacity—from 100 kilowatts to 12 megawatts—and can be installed in diverse environments including land, offshore, and deep waters with floating designs. Key factors influencing electricity production include wind speed, blade radius (with power increasing exponentially as blade size grows), and air density, which depends on altitude, temperature, and pressure. The wind energy sector also presents significant job growth opportunities; for example
energywind-energyrenewable-energywind-turbinesclean-energysustainable-energywind-powerFord PH to Launch Mustang Mach-E by 3Q This Year - CleanTechnica
Ford Philippines announced it will launch its first all-electric vehicle, the Mustang Mach-E, by the third quarter of 2025. The decision to introduce the Mach-E as its initial EV offering reflects Ford’s strategy to leverage the Mustang’s iconic muscle car heritage while transitioning into electrification. Pedro Simoes, Ford PH managing director, emphasized the Mustang Mach-E’s strong appeal due to its blend of traditional Mustang DNA with modern electric powertrain technology, positioning Ford as a credible player in the Philippine EV market. The Mustang Mach-E represents a significant shift for Ford, being the brand’s first production model designed from the ground up as a fully electric SUV that carries the Mustang’s performance-oriented legacy. Although official specifications for the Philippine market have not been released, the vehicle is expected to be sourced from Ford’s Mexico plant, with the Premium variant likely to be offered. This model is anticipated to feature a standard-range battery capable of over 400 kilometers per charge, balancing performance, features, and cost to
energyelectric-vehiclesFord-Mustang-Mach-EEV-launchautomotive-electrificationbattery-technologysustainable-transportationNew Quantum clock ticks accurately without wasting much energy
Researchers have developed a novel quantum clock design that significantly reduces energy waste while maintaining high precision in timekeeping. Traditional quantum clocks measure time by counting discrete, irreversible events, each generating entropy and requiring energy, leading to a direct trade-off between precision and energy consumption. The new approach abandons this model by allowing quantum excitations to evolve coherently and uninterrupted across a system, tracking the overall flow of time rather than individual ticks. This method, based on coherent quantum transport, avoids repeated measurements that produce entropy, thereby breaking the previously assumed linear relationship between precision and entropy production. The innovative clock operates on principles drawn from quantum many-body systems, where particles exhibit coordinated, wave-like behavior, enabling precise control with minimal thermodynamic cost. By trading off precision with resolution—similar to waiting for a larger quantity of sand to fall in an hourglass rather than counting individual grains—the clock achieves greater accuracy without proportionally increasing entropy. Theoretical models validate this concept, and experimental efforts, such as those underway at Ch
energyquantum-clockquantum-mechanicsentropytimekeepingquantum-transportenergy-efficiencyPorsche “Blasphemy” from Sacrilege Motors - CleanTechnica
Sacrilege Motors, a Connecticut-based company, is redefining classic Porsche restoration by converting air-cooled Porsche 911 models from 1974 to 1994 into bespoke electric vehicles. Their flagship projects, showcased at the 125th New York Auto Show, include the Enigma coupe and the Blackbird roadster. These conversions go beyond simple powertrain swaps; they involve meticulous disassembly, restoration, and electrification while preserving the original car’s character. Notably, the original flat-six engines are carefully removed and stored, making the conversion theoretically reversible. The electric powertrain, developed in partnership with UK-based Fellten, is a bolt-in system that uses the original engine and transmission mounts to maintain the 911’s legendary weight distribution and handling. The electric setup features a Tesla-sourced large-drive unit delivering about 500 horsepower and 500 Nm (369 lb-ft) of torque, enabling a 0–60 mph acceleration in under four seconds. A 62 kWh battery pack
energyelectric-vehiclesautomotive-restorationPorschebattery-technologyelectric-powertrainTeslaBattery life could be extended with US scientists' imaging technique
Researchers at UCLA have developed a novel imaging technique called electrified cryogenic electron microscopy (eCryoEM) that captures high-resolution images of lithium-metal batteries while they charge, at a scale smaller than the wavelength of light. This method involves rapidly freezing thin batteries in liquid nitrogen during charging to preserve and visualize the formation and growth of the corrosion layer over time. By compiling images taken at various time points, the researchers created a "flipbook" animation revealing how the corrosion film develops, providing critical insights into the electrochemical processes occurring under real reaction conditions—something previously unobservable with traditional postmortem techniques. The study found that the corrosion layer’s growth initially depends on how quickly lithium reacts (reaction-limited stage) and later slows down as electron diffusion through the layer becomes the limiting factor (diffusion-limited stage). Notably, the electrolyte’s reactivity plays a larger role in early-stage corrosion than previously understood, with a more inert electrolyte significantly reducing corrosion growth. These findings suggest that engineering
energylithium-metal-batterybattery-life-extensionelectron-microscopyeCryoEMbattery-designenergy-storage-materialsChinese carmaker's EV boasts 1,300-mile range, 47% thermal efficiency
Chinese automaker Geely has introduced the Galaxy A7 EM-i, a mid-size plug-in hybrid sedan featuring the new Leishen AI Hybrid 2.0 system. Set to launch in China in Q3 2025, the vehicle boasts an exceptional driving range of over 1,305 miles, achieved through a combination of a highly efficient 1.5-liter naturally aspirated engine and electric motor. The hybrid powertrain attains a class-leading thermal efficiency of 47.26% and delivers fuel consumption of 94 MPG in battery-depleted mode. The A7 EM-i offers two battery options, providing electric-only ranges of 34 or 75 miles, and targets affordability with a price range of approximately $14,000 to $18,200, positioning it against competitors like the BYD Qin L and Wuling Starlight. Geely has integrated advanced AI algorithms into the hybrid system to extend battery life by 15% via precise current management, alongside the Flyme
energyelectric-vehicleshybrid-technologyAI-in-automotivebattery-managementthermal-efficiencysmart-energy-managementUS researchers solve tokamak plasma mystery with elusive ‘voids’ discovery
Researchers at the University of California, San Diego, have developed a new theoretical model that may explain a longstanding discrepancy in nuclear fusion research related to plasma behavior at the edge of tokamak reactors. The study, led by physicists Mingyun Cao and Patrick Diamond, focuses on the plasma boundary—a critical region for sustaining fusion reactions and protecting reactor components from extreme heat. Previous simulations underestimated the width of the turbulent layer at the plasma edge, a problem known as the “shortfall problem,” which has hindered accurate predictive modeling of plasma dynamics. The breakthrough centers on previously overlooked structures called “voids,” which are inward-moving, density-depleted formations at the plasma edge. While past research emphasized outward-moving, density-enhanced “blobs,” the role of voids remained unclear. Cao and Diamond’s model treats voids as coherent, particle-like entities that, as they move from the cooler plasma edge toward the hotter core, generate plasma drift waves by interacting with steep temperature and density gradients. These waves transfer
energynuclear-fusiontokamakplasma-physicsfusion-reactorturbulence-modelingplasma-boundaryAustralia Achieves 12% Plugins in May - CleanTechnica
In May 2025, the Australian automotive market remained strong with 109,425 light vehicles sold, of which 12% were plug-in electric vehicles (EVs). Battery electric vehicles (BEVs) accounted for 9.2% of sales with 10,065 units sold, while plug-in hybrid electric vehicles (PHEVs) made up 2.8% with 3,081 units. Despite a slight decline in EV deliveries in the first five months of 2025 compared to the same period in 2024 (33,976 vs. 40,966), optimism remains high due to new EV model launches and a resurgence in demand. Tesla’s Model Y led the BEV market in May with 3,580 sales, marking a significant increase from April and making it the fourth best-selling vehicle overall in Australia. Government policies have notably influenced PHEV sales, with a spike in April as businesses sought to avoid Fringe Benefits Tax, followed by a drop in
energyelectric-vehiclesbattery-electric-carsplugin-hybridsEV-marketautomotive-industryclean-energyA Long-Term Take On California's Net Metering Policies - CleanTechnica
The article discusses California’s evolving net metering policies, focusing on the transition to “Net Metering 3.0” and its long-term implications. A former electrician in California’s power industry provides a critical perspective, describing the new policy as a financial gain for utilities at the expense of residential solar customers. Under earlier net metering rules, residential solar owners could offset their electricity use on a near one-to-one basis, effectively reducing their bills to zero if their solar production matched their consumption. Utilities benefited by acquiring excess solar power at low fixed rates and reselling it at higher commercial rates during peak demand, creating a mutually beneficial arrangement. However, with Net Metering 3.0, utilities pay solar customers closer to wholesale rates for excess power, significantly reducing the financial value of residential solar systems. Customers can no longer fully offset their electricity bills due to lower compensation for surplus energy and the introduction of fixed monthly grid connection charges. This shift devalues residential solar investments, requiring larger and more expensive
energynet-meteringsolar-powerCalifornia-energy-policyphotovoltaic-systemselectricity-ratesutility-companiesGeological CO₂ Storage: Massive Scale, Hidden Risks, Eternal Monitoring - CleanTechnica
The article critically examines the viability of geological carbon dioxide (CO₂) sequestration as a large-scale climate mitigation strategy. While geological storage has gained traction, partly due to less aggressive electrification scenarios and fossil fuel industry influence, real-world experience from enhanced oil recovery (EOR) operations raises serious concerns about its effectiveness. EOR wells, which inject tens of millions of tonnes of CO₂ annually, already exhibit non-negligible leakage rates and mechanical integrity failures. These wells operate under less demanding conditions than dedicated sequestration wells, which must contain supercritical CO₂ under high pressure and corrosive environments for centuries or millennia. The higher risks of leakage and containment failure in future sequestration projects pose a significant challenge to meeting climate goals that require near-zero leakage over very long timescales. Scaling geological sequestration to the levels projected by organizations like the International Energy Agency—around 7.6 gigatonnes of CO₂ per year by mid-century—would require an unprecedented expansion of current capacity
energycarbon-capturegeological-storageCO2-sequestrationclimate-mitigationenhanced-oil-recoveryenvironmental-monitoringTesla & Musk — Tied at the Hip, and the Mouth - CleanTechnica
The article "Tesla & Musk — Tied at the Hip, and the Mouth" by eveee, published on CleanTechnica, explores how Elon Musk’s personal ideology and leadership style have deeply influenced Tesla’s corporate identity and public perception. Musk’s conservative libertarian beliefs, emphasizing individualism and “free speech absolutism,” shape his management approach, which is described as highly centralized, paranoid about losing control, and dismissive of authority, regulation, and employee rights. This founder-driven style, rooted in an Ayn Rand-inspired philosophy, has led Musk to treat Tesla as a small personal venture rather than a mature, large company, hindering its ability to evolve with seasoned leadership. The article highlights how Musk’s personality and political actions have negatively impacted Tesla’s reputation and sales, particularly in Europe. For example, Tesla’s failure in Sweden is attributed to Musk’s disregard for the country’s strong cultural commitment to unions and collective bargaining, which soured public opinion well before controversies in Germany, France, and
energyelectric-vehiclesTeslaElon-Muskclean-technologyrenewable-energyautomotive-industryNepal’s Electric Leapfrog: How This Himalayan Nation Is Leading Global EV Adoption - CleanTechnica
Nepal, a Himalayan nation of 30 million people, is emerging as a global leader in electric vehicle (EV) adoption, with about 70% of new passenger vehicles sold recently being electric. This rapid transition defies the common notion that EVs are mainly viable in wealthy countries with advanced infrastructure. Nepal’s success is underpinned by its nearly 100% hydroelectric-powered grid, which supplies clean, reliable, and domestically produced electricity to 94% of the population as of 2024. This extensive electrification, supported by investments in grid reliability and infrastructure upgrades, enables the country to reduce emissions and cut costly petroleum imports, which exceeded $2.5 billion in 2022/23. The shift to EVs has been driven by strategic government policies and a diversified vehicle market featuring Chinese, Indian, Korean, and European manufacturers. Kathmandu, the capital, now hosts a wide range of electric cars and a growing fleet of electric three-wheelers (safa tempos) and
energyelectric-vehiclesrenewable-energyhydroelectric-powergrid-electrificationsustainable-transportationenergy-infrastructure2 Millions Jobs at Risk if Republicans Repeal Clean Manufacturing Tax Credits - CleanTechnica
The article discusses the significant job risks posed by a Republican-led House bill that seeks to repeal the Clean Manufacturing Tax Credits established under the Inflation Reduction Act of 2022. According to an analysis by the BlueGreen Alliance, over two million jobs across the manufacturing sector could be lost if the bill becomes law. This includes nearly 300,000 direct manufacturing jobs, more than one million indirect jobs tied to supply chains, and approximately 643,000 induced jobs related to economic activity generated by these sectors. The Alliance emphasizes that these figures are based on company announcements and do not account for projects already canceled, suggesting the actual impact could be even more severe. The job losses would affect a range of states, including both traditionally Democratic and Republican ones, with California, Georgia, Michigan, Illinois, Tennessee, Arizona, and South Carolina each facing over 100,000 jobs at risk. The Alliance highlights that many of these states were won by President Trump in the 2024 election, underscoring the political
energyclean-manufacturingtax-creditsjob-riskInflation-Reduction-Acteconomic-impactmanufacturing-jobsXiaomi files solid-state EV battery patent with layered electrode design
Chinese tech giant Xiaomi has filed a patent for a solid-state battery featuring a novel layered electrode design aimed at addressing key challenges in ionic conductivity and energy density. The design incorporates multiple electrode layers around a current collector, with a solid polymer-metal salt electrolyte penetrating vertically to shorten ion travel distance and enhance performance. Xiaomi’s prototype boasts a cell-to-body (CTB) structure with a volume efficiency of 77.8%, a compact 120 mm battery pack height integrated into the vehicle floor, and delivers a CLTC-rated range exceeding 745 miles. It also supports fast charging, adding 500 miles of range in just 10 minutes. The design is reportedly compatible with existing lithium battery manufacturing lines, facilitating potential mass production and easing the transition to solid-state technology. Xiaomi’s move reflects growing momentum in the automotive industry toward solid-state batteries, which promise improvements in safety, energy density, and thermal stability compared to traditional lithium-ion cells. Major automakers like BMW, Toyota, SAIC, and battery
energysolid-state-batteryelectric-vehiclebattery-technologyenergy-storagefast-charginglithium-ion-batteryPuerto Rico Contemplates A Reunion With Spain - CleanTechnica
The article discusses a movement in Puerto Rico advocating for reunification with Spain, reflecting a desire among some residents to escape the island’s current status as a U.S. territory. Puerto Rico was a Spanish colony for over four centuries until the Spanish-American War in 1898, after which it became a U.S. possession. Although Puerto Ricans are U.S. citizens, they lack voting representation in Congress and cannot vote in presidential elections, while many do not pay federal taxes. This political limbo, combined with economic challenges such as high costs for imported goods and electricity (due in part to shipping restrictions favoring U.S.-registered vessels), fuels dissatisfaction. The movement, led by José Lara and called Adelante Reunificacionistas, seeks to make Puerto Rico the eighteenth autonomous community of Spain, citing shared language and culture as key reasons. Supporters of reunification argue that Spanish governance could help Puerto Rico overcome economic and cultural stagnation experienced under U.S. rule. The article highlights historical grievances
energyelectricitypower-plantsoil-importcarbon-emissionsPuerto-Rico-energyenergy-costsWorld-first open-door large-scale fire test completed on China battery
Hithium has completed a groundbreaking large-scale open-door fire test on its battery energy storage system (BESS), demonstrating exceptional fire safety performance under extreme conditions. The test, conducted by UL Solutions and witnessed by certified U.S. fire protection engineers, adhered to stringent UL 9540A and NFPA 855 safety standards. Key challenges included fully open container doors to allow unrestrained combustion, minimal 15cm spacing between units, deactivation of all fire suppression systems, and testing at 100% state of charge. Despite 15 hours of intense combustion with flames exceeding 1300°C, the system’s multi-layered passive fire protection and thermal isolation prevented fire propagation to adjacent containers and maintained structural integrity. This successful trial highlights Hithium’s autonomous fire resistance capabilities without relying on active suppression, validating the robustness of its passive safety architecture. Industry experts have praised the test as a significant advancement in energy storage fire safety, providing a replicable and practical framework for future safety standards. H
energybattery-energy-storage-systemfire-safetythermal-runawaypassive-fire-protectionUL-9540Aenergy-storage-testingChinese firm's hybrid EV offers 1,250-mile range with blade battery
Chinese automaker Chery is set to launch its flagship plug-in hybrid sedan, the Fulwin A9L, in China in early July 2025, with a global rollout planned for the first quarter of 2026. The Fulwin A9L, competing in the mid-to-large sedan segment against models like BYD’s Han DM-i, features Chery’s Kunpeng Super Hybrid Electric 6.0 system paired with a 1.5T turbocharged engine and a 33.7 kWh lithium iron phosphate Kunpeng Blade Battery. This setup delivers a pure electric range of up to 161 miles and a combined total range of approximately 1,243 miles, making it notable for its long-distance efficiency. The vehicle also incorporates advanced driver assistance technologies, including a suite of 27 sensors and the Orin Y 200T computing platform, enabling semi-autonomous features such as Navigate on Autopilot and intelligent obstacle avoidance. At the 2025 International Automotive and Supply
energyhybrid-electric-vehiclelithium-iron-phosphate-batteryblade-batteryautonomous-drivingdriver-assistanceautomotive-technologyGeothermal Industry Sends A 163-Gigawatt Letter To Fossil Fuels
The article discusses the renewed focus on geothermal energy in the United States amid President Donald Trump’s second term, which prioritized coal, oil, gas, and geothermal energy under a “National Energy Emergency” declaration issued on January 20. While traditional renewables like wind and solar were excluded from this emergency status, geothermal energy, along with biofuels and hydropower, was recognized as a critical energy resource. Despite this inclusion, legislative support—particularly tax provisions in the federal budget bill (BBB)—has yet to fully materialize, leaving geothermal’s financial incentives uncertain as Congress debates the final bill. Significantly, the US geothermal industry is poised for growth, bolstered by new Department of Energy research and development programs that leverage enhanced geothermal systems (EGS) technology. This approach uses advanced drilling techniques adapted from oil and gas to create viable geothermal power sites beyond the limited traditional locations west of the Rockies. A recent US Geological Survey assessment revealed that New Mexico alone holds an estimated 163 gigawat
energygeothermal-energyrenewable-energyUS-energy-policybiofuelshydropowerenergy-infrastructureGerman firm advances plan to build world's first nuclear fusion plant
Proxima Fusion, a Munich-based start-up spun out from the Max Planck Institute for Plasma Physics in 2023, has secured €130 million ($150 million) in its Series A funding round, bringing total funding to over €185 million ($213 million). The company aims to build the world’s first commercial nuclear fusion power plant using a stellarator design, leveraging a simulation-driven engineering approach and high-temperature superconducting (HTS) technology. Key near-term milestones include completing the Stellarator Model Coil (SMC) by 2027 to demonstrate HTS application and selecting a site for its demonstration stellarator, “Alpha,” which is planned to begin operations by 2031. Alpha is intended to achieve net energy gain (Q>1), a critical step toward a functional fusion power plant. Proxima Fusion’s technical strategy centers on the “Stellaris” concept, the first peer-reviewed stellarator design integrating physics, engineering, and maintenance from inception. This quasi-isodynamic stellarator
energynuclear-fusionfusion-power-plantstellaratorhigh-temperature-superconductorsclean-energyenergy-innovationTop BYD Exec Says Chinese EV Price War "Not Sustainable" & "Not Healthy" - CleanTechnica
The article discusses the ongoing price war among Chinese electric vehicle (EV) manufacturers, highlighting concerns about its sustainability and impact on the industry. Chinese automakers have been aggressively cutting EV prices, with BYD recently reducing prices on up to 22 models by as much as 30%. While BYD remains profitable and continues to grow—reporting about 15% growth in early 2025 and aiming for 30% growth with a 5.5 million vehicle sales target—it acknowledges that the current price war is "not sustainable" or "healthy." Most other Chinese EV makers, unlike BYD and Tesla, are still losing money on their EV operations, and the intense price competition is hurting overall profitability. Chinese regulators, including the Ministry of Industry and Information Technology (MIIT), have warned automakers to halt the price war to prevent further damage to the industry, signaling potential intervention. Meanwhile, BYD is pursuing aggressive international expansion, planning to invest $20 billion in Europe to establish a strong
energyelectric-vehiclesBYDautomotive-industryprice-warclean-technologyEV-marketWood Pellet Mills Are Prone to Catching Fire. Why Build Them in California?
The article highlights the inherent fire risks associated with wood pellet mills, which produce highly flammable compressed wood products used for heating and grilling. Since 2010, at least 52 fires have occurred at such facilities across the US, with many of the largest mills experiencing fires or explosions. The biomass company Drax, a major player in the industry, has a history of fire-related incidents at its facilities in the UK and Louisiana. Despite these safety concerns and ongoing lawsuits, Drax is moving forward with plans to build two new pellet mills in California, through its partner Golden State Natural Resources (GSNR), claiming that their operations will help mitigate wildfire risks by utilizing dead or dying trees from nearby forests. The proposed mills in Tuolumne and Lassen counties, both forested and wildfire-prone areas, have sparked opposition from local residents and experts who question the safety and environmental impact of manufacturing wood pellets in these regions. Concerns include inadequate communication with nearby communities, potential overharvesting of biomass by
energybiomass-energywood-pelletsfire-safetyrenewable-energywildfire-mitigationsustainable-materialsThe EPA, Power Plants And Planetary Boundaries - Everything Is Connected - CleanTechnica
The article discusses the recent announcement by the U.S. Environmental Protection Agency (EPA) to repeal all greenhouse gas (GHG) emissions standards for fossil fuel-fired power plants, effectively eliminating regulations established under previous administrations, notably those of Barack Obama and Joe Biden. The EPA’s justification centers on the claim that carbon dioxide emissions from thermal power plants have decreased from about 5.5% of global emissions in 2005 to approximately 3% today, arguing that further reductions would have minimal impact on public health. The proposal includes repealing emission guidelines for existing fossil fuel steam units and carbon capture and sequestration (CCS) standards for coal-fired plants and new turbines, signaling a significant rollback of environmental protections. Supporters of the rollback, including EPA Administrator Lee Zeldin, former President Donald Trump, and industry representatives like the National Mining Association and West Virginia Governor Patrick Morrisey, praise the move as a boost to coal power, energy dominance, and economic development. They emphasize the importance of
energyEPApower-plantsgreenhouse-gas-emissionsfossil-fuelscarbon-captureenvironmental-policySharks & Rays Found Using Offshore Wind Farms As Habitat - CleanTechnica
A recent study by Wageningen University & Research reveals that offshore wind farms in the Netherlands serve not only as energy producers but also as important habitats for marine life, particularly sharks and rays (elasmobranchs). Using environmental DNA (eDNA) sampling—a non-invasive method detecting species presence through DNA traces in seawater—researchers confirmed the active presence of five elasmobranch species across four wind farms: Borssele, Hollandse Kust Zuid, Luchterduinen, and Gemini. The thornback ray was the most frequently detected, present year-round in several sites, while the detection of migratory basking sharks during winter provided new insights into their seasonal movements. The study highlights that offshore wind farms may act as safe havens for vulnerable species by prohibiting seabed-disturbing activities like trawling, allowing benthic ecosystems to recover and offering more stable habitats. Researchers caution against permitting bottom trawling within these zones to preserve their protective benefits. The findings support
energyoffshore-wind-farmsmarine-habitatenvironmental-impacteDNA-monitoringrenewable-energymarine-conservationA No Kings Day Demand For Climate Action And Democracy Protections - CleanTechnica
The article emphasizes the importance of standing up for social safety programs and democratic protections on No Kings Day, highlighting critical programs such as Supplemental Nutrition Assistance, Medicare, Medicaid, the Affordable Care Act, and veterans' services. It stresses the need to defend immigrants' rights and the right to peaceful assembly while calling for urgent climate action. The article critiques former President Donald Trump’s policies, arguing they undermine the U.S.’s ability to combat climate change, damage international alliances like the Paris Agreement, and threaten democratic principles by concentrating power in a manner reminiscent of monarchy. The piece explains that the Founding Fathers designed the U.S. government as a republic with checks and balances to prevent tyranny, contrasting this with the autocratic tendencies seen in Trump’s leadership. It notes that the climate crisis is a unique challenge that spans both present and future generations, requiring consistent, long-term policies rather than erratic measures like the “TACO” (Trump Always Chickens Out) tariff approach. The article calls for strong,
energyclimate-changeenvironmental-policyrenewable-energysustainabilityclimate-actionfossil-fuelsPassive tech sets cooling record for overheating AI data centers
Engineers at the University of California, San Diego have developed a groundbreaking passive cooling technology for data centers that sets a new record by handling over 800 watts per square centimeter of heat dissipation. This fiber-based cooling system uses a specially engineered membrane with interconnected pores that passively removes heat through evaporation, eliminating the need for energy-intensive fans, compressors, or pumps. Unlike traditional cooling methods, this approach leverages capillary action to wick liquid across the membrane surface, where evaporation naturally draws heat away from electronic chips, offering a quieter and more energy-efficient alternative. The innovation addresses longstanding challenges in adapting evaporative cooling to the extreme thermal loads of modern AI data centers, where conventional porous membranes either clogged or caused unstable boiling. By optimizing pore size and reinforcing the membrane mechanically, the UCSD team achieved stable, high-performance cooling over multiple hours. While the technology currently operates below its theoretical maximum, efforts are underway to integrate it into cold plates for direct processor cooling and to commercialize the solution through a startup
energycooling-technologydata-centerspassive-coolingfiber-membranethermal-managementenergy-efficiencyAbandoning The Market - CleanTechnica
The article "Abandoning The Market" from CleanTechnica reflects on the author's personal journey from conservative political views to recognizing the undeniable reality of climate change, sparked by observing the 2003 Hardiness Zone map that showed significant warming in their local area. The map, which was suppressed by the George W. Bush administration due to its implications about climate change, revealed a temperature increase of over 10°F in the author's region, bringing new environmental challenges like Lyme disease. This denial of clear scientific evidence by a political party led the author to reconsider their political alignment, especially after witnessing the resistance to acknowledging climate change among like-minded conservatives. The author connects this personal experience to a broader geopolitical and economic context, highlighting a recent International Energy Agency paper that underscores China's dominant position in clean energy investment and markets. The U.S., by contrast, has lagged behind due to political denial and lack of engagement with the realities of climate change. The article critiques the entrenched political denial in the U.S.
energyclimate-changeglobal-warmingrenewable-energysolar-powerwind-powercarbon-footprintWhy BYD Is Now The Clear EV Leader - CleanTechnica
The article highlights BYD's emergence as the clear leader in the electric vehicle (EV) market, emphasizing the company's strong engineering and problem-solving approach under CEO Wang Chuanfu. Rather than focusing on past successes or promises, BYD addresses challenges head-on, turning criticism into motivation. For example, despite earlier doubts about their intelligent driving technology, BYD now sells 79% of its vehicles equipped with advanced driver-assistance systems (ADAS) in China, outperforming competitors including Tesla in real-world tests. BYD has also initiated a "payment war" by shortening supplier payment terms, pressuring competitors and accelerating industry consolidation. The article further debunks common criticisms of EVs by showcasing BYD’s advancements: EVs are now less expensive than internal combustion engine vehicles in several markets; BYD’s revenue and profit margins are growing even as prices decline; their product range is broad and specialized; charging speeds have improved dramatically with 400+ km range added in five minutes; and battery technology offers
energyelectric-vehiclesbattery-technologyfast-chargingEV-infrastructureautomotive-innovationsustainable-transportationRepublican Budget Bill to Raise People's Energy Prices - CleanTechnica
The article from CleanTechnica discusses the potential negative impacts of a Republican budget bill that aims to repeal clean energy tax credits established under the Inflation Reduction Act. According to a report by NERA Economic Consulting, commissioned by the Clean Buyers Energy Association, removing these technology-neutral tax incentives—such as the §45Y production tax credit and §48E investment tax credit—would lead to higher energy prices across 19 states. The analysis highlights that without these credits, energy systems would rely more heavily on traditional, costlier energy sources, resulting in significant electricity price increases, with seven states facing double-digit percentage hikes between 2026 and 2032. The broader economic consequences of repealing clean energy tax credits are severe. The report warns that inflated energy costs would suppress commercial and industrial activity, reduce labor and capital demand, and cause wage losses and declining household incomes. This combination would constrain consumer spending and economic resilience, leading to shrinking economies, increased financial strain on households, and potential job losses in key
energyclean-energytax-creditselectricity-priceseconomic-impactrenewable-energyenergy-policyAmazon joins the big nuclear party, buying 1.92 GW for AWS
Amazon has joined a growing trend among major tech companies by securing 1.92 gigawatts of electricity from Talen Energy’s Susquehanna nuclear power plant in Pennsylvania to power its AWS cloud and AI servers. Unlike an earlier plan where Amazon intended to build a data center adjacent to the plant and draw power directly—bypassing the grid and transmission fees—regulatory concerns led to a revised agreement. The current deal positions Amazon as a grid-connected customer, paying transmission fees like other users, with the arrangement set to last through 2042. Transmission infrastructure upgrades are planned for spring 2026 to support this setup. Beyond the power purchase, Amazon and Talen Energy plan to explore building small modular reactors (SMRs) within Talen’s Pennsylvania footprint and expanding output at existing nuclear plants. Such expansions typically involve optimizing fuel enrichment, turbine upgrades, or other modifications to increase power generation. This move aligns Amazon with peers like Microsoft and Meta, who have also made significant investments in nuclear
energynuclear-powerAWScloud-computingsmall-modular-reactorsclean-energypower-purchase-agreementZevo’s EV-only car-share fleet is helping Tesla owners make money
Zevo is a Dallas-based peer-to-peer car-sharing startup founded in 2021 by Hebron Sher and Saimah Chaudhry, focusing exclusively on electric vehicles (EVs), primarily Teslas. The company emerged from Sher’s frustration with Elon Musk’s unfulfilled promise of Tesla robotaxis generating income for owners. Zevo has rapidly grown in about 10 months, raising $6 million in funding and tracking over $8 million in annualized recurring revenue, with a waitlist exceeding 3,500 customers. Most renters are gig economy workers using Zevo EVs for ride-hailing or delivery services, attracted by the platform’s affordability and streamlined, contactless rental process that leverages EVs’ technological capabilities. Zevo’s “secret sauce” lies in its deliberate avoidance of large venture capital funding, opting instead for private capital to maintain a sustainable growth model without excessive spending. This approach has allowed Zevo to offer higher earnings to vehicle owners—who can recoup 35%
energyelectric-vehiclescar-sharingEV-fleetcontactless-technologygig-economytransportation-innovationStartups Weekly: No sign of pause
The article "Startups Weekly: No sign of pause" highlights the continued dynamism in the startup ecosystem despite major industry events like WWDC, with June seeing numerous significant deals and IPO announcements. It underscores that startup trajectories are often nonlinear, exemplified by neobank Chime’s near-collapse in 2016 before its highly anticipated IPO. Other notable startups include Nucleus Genomics, which offers controversial embryo genetic testing, and Automattic, the WordPress.com owner, which continues to support its personal CRM app after raising substantial venture capital. The piece also details key venture capital and funding developments, spotlighting several large and strategic investments. Multiverse Computing raised about $215 million for its technology that reduces the size and cost of large language models, while enterprise AI company Glean’s valuation surged to $7.2 billion. Other highlighted startups include Fervo Energy, backed by Bill Gates’ Breakthrough Energy Catalyst for geothermal projects; German nuclear fuel startup Proxima Fusion; delivery robot company Coco Robotics
energygeothermal-energyfusion-energyroboticsdelivery-robotsAI-integrationstartup-fundingRepublicans in House Who Don't Want Clean Energy Tax Credits Cut Look to Senators to Save Them - CleanTechnica
The article discusses the political dynamics surrounding clean energy and electric vehicle tax credits established by the Inflation Reduction Act of 2022. Although these incentives disproportionately benefit districts represented by Republican lawmakers, many Republicans initially voted to cut these tax credits to align with party and oil and gas industry interests. However, 13 Republican House members from vulnerable districts, led by Rep. Jen Kiggans (R-VA), have recently expressed strong concerns about provisions that would phase down these incentives and impose strict new supply chain requirements, warning that such measures could threaten billions in investments and thousands of jobs. These lawmakers have appealed to Senate leaders, urging them to restore the tax credits in the final bill to support U.S. energy producers, manufacturers, and workers, emphasizing the need for a "pro-energy growth" approach that balances taxpayer protection with economic opportunity. Notably, while tax credits for renewables face cuts, incentives for nuclear power and biofuels remain intact, reflecting political preferences that may not align with maximizing competitiveness against
energyclean-energytax-creditsrenewable-energyInflation-Reduction-Actenergy-policyenergy-investmentNASA's nuclear rocket program canceled as Trump budget slashes space science
The Trump administration’s proposed NASA budget for fiscal year 2026 includes drastic cuts to space science funding, slashing it from $7.5 billion in 2025 to $3.9 billion. Among the programs targeted for elimination is DRACO, a nuclear thermal propulsion demonstrator developed by NASA and DARPA. DRACO was designed to use a nuclear reactor to heat liquid hydrogen fuel to extremely high temperatures, potentially doubling the efficiency of traditional chemical rockets and significantly reducing travel times for deep space missions, such as trips to Mars. The cancellation comes despite DRACO nearing its estimated launch date and reflects a broader pattern of prioritizing projects with quicker political or financial returns over long-term, generational technologies. The budget proposal has faced strong criticism from scientists, lawmakers, and space policy experts who warn that such cuts could lead to a decline in U.S. leadership in space exploration. NASA’s acting administrator, Janet Petro, justified ending nuclear propulsion projects by stating that near-term human exploration and science goals do
energynuclear-propulsionNASAspace-technologyDRACOspacecraftspace-explorationNew Electric Boat Line Coming - CleanTechnica
ACEL Power, a Canadian leader in intelligent electric propulsion systems, has partnered with Madrid-based boat builder Vector Náutico to launch a new electric boat line called MOLA-e. Designed for coastal and inland cruising, the boats measure 5.99 meters in length and come in two configurations: a 50HP model with a 32 kWh lithium iron phosphate (LFP) battery and a 75HP model with a 43 kWh LFP battery. These batteries offer high energy density, extended lifecycle, and enhanced thermal stability, enabling zero-emission propulsion without sacrificing performance. The MOLA-e line aims to combine luxury yacht design with the accessibility of a day cruiser, featuring optimized hull geometry for improved range and handling, as well as wide swim platforms for easy water access. The first units are expected to debut in mid-2025, with sea trials and showcase events planned across Spain. Pricing and customization details will be released closer to the launch. Both companies emphasize sustainability and reliability, positioning
energyelectric-boatselectric-propulsionLFP-batterysustainable-transportationzero-emissionmarine-technologyNew zinc-iodine battery retains 99.8% capacity after 500 cycles
Scientists at the University of Adelaide in Australia have developed a novel dry electrode technology for zinc-iodine batteries that significantly enhances their performance and stability. This breakthrough involves mixing active materials as dry powders and rolling them into thick, self-supporting electrodes, combined with adding 1,3,5-trioxane to the electrolyte. This chemical induces the formation of a flexible protective film on the zinc anode during charging, preventing dendrite growth—needle-like structures that can cause short circuits. The new electrodes achieve a record-high active material loading of 100 mg/cm², resulting in pouch cells retaining 88.6% capacity after 750 cycles and coin cells maintaining 99.8% capacity after 500 cycles. Zinc-iodine batteries are considered safer, more sustainable, and cost-effective alternatives to lithium-ion batteries for large-scale and grid energy storage, but have historically lagged in performance. This innovation addresses those limitations by reducing iodine leakage, minimizing self-discharge, and extending cycle life
energybattery-technologyzinc-iodine-batteryenergy-storagesustainable-energygrid-storagematerials-scienceWorld's fastest supercomputer helps design high-speed VTOL plane
XTI Aerospace is accelerating the development of its TriFan 600 vertical takeoff and landing (VTOL) aircraft by leveraging the computational power of the Oak Ridge National Laboratory’s Frontier supercomputer, previously the world’s fastest. Using over 1,500 complex computational fluid dynamics (CFD) simulations on Frontier, XTI engineers have refined the aircraft’s aerodynamic design, enabling more efficient and precise modeling across various flight scenarios. The TriFan 600 is designed to carry six passengers at speeds up to 345 mph (555 km/h), cruise at 25,000 feet, and reduce emissions by 80% through the use of sustainable aviation fuels. The next development stages include wind tunnel testing and FAA certification. The Frontier supercomputer’s exascale-class performance—capable of over a quintillion calculations per second—has provided XTI a critical advantage by compressing engineering timelines and reducing design risks. In addition to aerodynamic improvements, XTI recently enhanced the TriFan 600’s fuel system
energysustainable-fuelsVTOL-aircraftsupercomputer-simulationaerodynamic-designcomputational-fluid-dynamicsaviation-technologyUS wastewater plant gets 240-kW solar canopy, cuts power use by 30%
A new 240-kilowatt solar photovoltaic canopy has been installed at the Pendleton Wastewater Treatment and Resource Recovery Facility (WWTRRF) in Oregon, marking a significant advancement in the city’s efforts to enhance energy resilience and sustainability. The solar canopy is expected to generate approximately 325,000 kWh of electricity annually, offsetting around 30% of the facility’s total energy consumption and reducing operational costs. Beyond energy production, the canopy shades the facility’s chlorine contact chamber, which helps improve water quality, lower effluent temperatures, and support a healthier aquatic ecosystem. The project, delivered through an Energy Savings Performance Contract (ESPC) with Ameresco, a Massachusetts-based energy solutions provider, represents a milestone in infrastructure improvement for Pendleton. It was funded through a combination of state grants, utility incentives, and city resources. City officials and Ameresco emphasized the canopy’s role in promoting economic benefits, operational efficiency, and environmental health. Future plans include adding a battery energy storage system (
energysolar-powerwastewater-treatmentrenewable-energyenergy-efficiencyinfrastructuresustainabilityWorld’s most powerful trencher to bury cables 18 feet under seabed
Denmark-based power-cable specialist NKT has developed the T3600, the world’s most powerful subsea trencher, delivering 3,600 hp and capable of burying cables up to 5.5 meters (18 feet) beneath the seabed. This remotely operated vehicle is designed to protect high-voltage export cables from physical threats such as anchors, fishing gear, and sabotage, which have become more significant with the growth of offshore wind farms and increased undersea traffic. The trencher is scheduled for commercial service in 2027 and will coincide with the launch of NKT’s new cable-lay vessel, Eleonora, built to manage the longer and heavier export cables required by giga-scale wind projects. The project anchors strongly in the UK maritime supply chain, with engineering firm OSBIT contracted to design and build the trencher and its launch-and-recovery system, supporting local employment and reducing operational risks. The T3600 represents a significant advancement in subsea trenching technology
energyrenewable-energysubsea-trencheroffshore-windpower-cablesremote-operated-vehiclecable-protectionMeta partners with US energy startup for 150 MW geothermal plant
Meta has partnered with US geothermal startup XGS Energy to develop a 150-megawatt geothermal power plant in New Mexico. Unlike a traditional power purchase agreement, this collaboration aims to advance geothermal energy development rather than directly securing power for Meta. The exact location of the plant remains undisclosed. This move reflects a growing trend among tech giants to incorporate geothermal energy into their clean energy strategies, given its ability to provide reliable, 24/7 emission-free electricity—an increasingly critical factor for energy-intensive data centers supporting AI and cloud computing. XGS Energy distinguishes itself with a closed-loop geothermal system that circulates water through a sealed well, preventing water loss common in traditional open-loop systems. The company also uses a proprietary heat-transfer mud to enhance heat absorption from surrounding rocks. Although still in development, XGS has raised $20 million in Series A funding to build a commercial prototype in California, with the Meta partnership potentially accelerating large-scale deployment. Research suggests advanced geothermal systems could supply up to two-thirds
energygeothermal-energyclean-energyMetaXGS-Energyrenewable-energypower-plantSwedish energy firm's tidal kite achieves 25% power output increase
Swedish ocean energy developer Minesto has achieved a significant milestone with its Dragon 12 (Luna) tidal energy system, deployed in the Vestmannasund area of the Faroe Islands. By extending the tether length by 10 meters, the 25–28 tonne underwater kite with a 12-meter wingspan increased its power output by 25 percent, fully matching performance predictions. This success validates Minesto’s simulation models and supports the commercial viability of its unique subsea kite technology, which generates electricity by flying in a controlled figure-of-eight pattern underwater, propelled by tidal currents. The Dragon 12 system, part of a broader project aiming for a total capacity of 10 MW, has demonstrated technical resilience and operational stability since its grid connection in early 2024. Minesto plans to scale up with an upgraded Dragon 12 model featuring a 1.75 MW generator and improved wing design for the Hestfjord site, forming the foundation for the 10 MW Dragon Farm. This
energytidal-energyrenewable-energyunderwater-kiteMinestopower-output-increasesubsea-technologyWorld’s first art-painted rocket launched into outer space by China
In a groundbreaking collaboration, contemporary artist Jacky Tsai and Chinese aerospace company LandSpace launched the world’s first fully art-painted orbital rocket, the Zhuque-2 Enhanced (ZQ-2E Y2). Standing nearly 50 meters tall, the rocket was entirely covered with vibrant aerospace-grade paints depicting the ancient Chinese legend of Chang’e flying to the moon. The artwork, which flows continuously from nose to base, integrates traditional Eastern storytelling with bold, modern visual techniques, transforming the rocket into a unified visual narrative rather than mere surface decoration. This project required innovative materials and close cooperation between artists and engineers to ensure the paint could withstand extreme launch conditions without compromising the rocket’s performance. The successful launch and orbit insertion of the ZQ-2E Y2 validated this pioneering fusion of art and aerospace engineering, proving that complex visual art can be integrated into space vehicles without affecting functionality. Painted segments recovered after stage separation serve as tangible artifacts symbolizing the intersection of science and storytelling. This initiative redefines
energyaerospacematerialsrocket-technologyaerospace-engineeringaerospace-paintsspace-launchNew nuclear fuel in US blends thorium, uranium to cut waste, cost
US scientists at Idaho National Laboratory (INL), in partnership with Clean Core Thorium Energy and Texas A&M University, have developed and tested a novel nuclear fuel called ANEEL (Advanced Nuclear Energy for Enriched Life). This fuel blends thorium with high-assay low-enriched uranium (HALEU), enriched between 5% and 20% uranium-235, aiming to reduce nuclear waste, enhance reactor safety, and lower operational costs. Unlike typical fuels used in pressurized heavy-water reactors (PHWRs) that contain less than 0.72% uranium-235, ANEEL’s design is proliferation-resistant and can be used in existing PHWRs without requiring reactor or fuel bundle modifications. The ANEEL fuel pellets, fabricated with a proprietary thorium-uranium oxide blend featuring an annular shape for gas management, underwent months of irradiation testing at INL’s Advanced Test Reactor (ATR). Initial post-irradiation examinations revealed that the fuel maintained its structural
energynuclear-fuelthoriumuraniumadvanced-reactorsnuclear-waste-reductionreactor-safetyMassive US device to unlock fusion secrets by recreating solar storm
The Princeton Plasma Physics Laboratory (PPPL) has launched a groundbreaking facility called the Facility for Laboratory Reconnection Experiments (FLARE) to study magnetic reconnection, a powerful process where magnetic field lines snap and reconnect, releasing vast energy. This phenomenon, which drives solar flares and disrupts technologies like GPS and power grids on Earth, also affects fusion reactors by interfering with plasma stability. FLARE, an SUV-sized device capable of discharging over 6 million joules—enough energy to power a thousand homes for five seconds—enables scientists to recreate and analyze these cosmic-scale events in a controlled laboratory setting, something previously impossible with spacecraft or computer simulations. FLARE’s unique design allows it to simulate multiple reconnection sites simultaneously, addressing a major gap in current research that has only observed single “X-points” where magnetic lines reconnect. This capability could provide the first experimental evidence of multi-point reconnection, offering new insights into how reconnection heats plasma and impacts large astrophysical systems
energyfusion-energymagnetic-reconnectionplasma-physicssolar-stormspower-gridslaboratory-experimentsChina’s liquid rocket engine clears major trial for cargo missions
China’s new liquid-fueled rocket engine, designed for the medium-lift Kinetica-2 launch vehicle, successfully passed a critical full-thrust test at CAS Space’s Liquid Propulsion Systems Test Center near Guangzhou. The test demonstrated stable engine performance and full-duration burn, validating the first-stage power system that will drive the core booster during liftoff. This facility is unique in China for its capability to test engines up to 200 tons of thrust and full-stage systems up to 400 tons, marking a significant advancement in China’s propulsion testing infrastructure. Kinetica-2, standing 52 meters tall with a liftoff mass of 625 metric tons and thrust capacity of 766 tons, is designed to deliver up to 12 tons to low-Earth orbit or 8 tons to a sun-synchronous orbit. Its maiden flight is scheduled for September from the Jiuquan Satellite Launch Center, coinciding with the debut of Qingzhou, a new cargo spacecraft developed for rapid
energyrocket-engineliquid-propulsionspace-launchaerospace-technologycargo-spacecraftpropulsion-systemAre Those Viral ‘Cooling Blankets’ for Real?
The article examines the popular concept of "cooling blankets" circulating on social media, clarifying that most marketed products do not truly cool the body. While these blankets may be more breathable and less heat-retentive than traditional blankets, they do not actively lower body temperature; in fact, simply having no blanket is generally cooler. The article explains the physics behind temperature and heat transfer, emphasizing that heat flows from warmer to cooler objects until equilibrium is reached, and that "coolness" cannot be transferred. Blankets function primarily as insulators, slowing heat exchange between the body and the environment. When a person is hot and uses a blanket, it usually traps heat and makes them feel warmer unless the surrounding air is hotter than body temperature. However, a blanket initially cooler than the body can absorb some thermal energy, providing a brief cooling effect until temperatures equalize. The article suggests that an effective cooling blanket would need a high mass and specific heat capacity to absorb more body heat and maintain a cooler temperature
energythermal-energyheat-transferspecific-heat-capacityinsulationcooling-technologymaterials-scienceThis Chinese Spacecraft Is Traveling to One of Earth’s Quasi-Moons
The China National Space Administration (CNSA) has released the first image from its Tianwen-2 probe, currently over 3 million kilometers from Earth and en route to Kamo’oalewa, a near-Earth quasi-moon asteroid. Launched on May 29, 2023, Tianwen-2 aims to study Kamo’oalewa from a distance before landing on its surface in July 2026 to collect samples. After returning these samples to Earth, the spacecraft plans to use Earth’s gravity to slingshot toward another asteroid, 311P/PanSTARRS. The mission faces challenges such as landing on the asteroid’s low-gravity surface and will provide valuable data on the composition of rocky celestial bodies. Kamo’oalewa is one of seven known quasi-moons of Earth—asteroids that orbit the sun in a path similar to Earth’s but are not gravitationally bound to our planet. Discovered in 2016 near Hawaii, it is about
energyspace-explorationsolar-panelsspacecraftasteroid-samplingTianwen-2quasi-moonIran's nuclear, military sites hit by 200 Israeli jets, IDF claims
Israel launched a large-scale airstrike against Iran on Thursday night and Friday morning, deploying over 200 fighter jets to target more than 100 nuclear and military sites, including the Natanz nuclear facility. The Israel Defense Forces (IDF) claimed the strikes hit the "heart" of Iran’s nuclear program, aiming to disrupt Tehran’s production of enriched uranium, which Israel says is bringing Iran closer to developing nuclear weapons. Iranian state media reported significant casualties, including the deaths of Hossein Salami, chief of the Islamic Revolutionary Guards Corps, and six nuclear scientists, though these claims have not been independently verified. Iran denied any radiation increase at Natanz and stated that the Bushehr nuclear power plant was not targeted. The strikes occurred amid ongoing nuclear negotiations between the US and Iran, with the sixth round scheduled in Muscat, Oman. The International Atomic Energy Agency (IAEA) recently accused Iran of breaching its non-proliferation obligations by failing to disclose details about undeclared nuclear material
energynuclear-energymilitary-technologydronesdefense-systemsuranium-enrichmentMiddle-East-conflictWeak Aircraft Innovation Undercutting Aviation’s Green Transition - CleanTechnica
The article from CleanTechnica highlights concerns about the aviation industry's slow progress in innovating greener aircraft technologies, which threatens its ability to meet decarbonization targets. Ahead of the Paris Air Show, analysis by Transport & Environment (T&E) reveals that reliance on conventional fossil-fuel-powered aircraft and incremental improvements, such as re-engining older models, are insufficient. T&E’s modeling suggests that with ambitious innovation—such as the development and deployment of zero-emission aircraft—European aviation could improve efficiency by up to 13-17% by 2050, potentially reducing CO₂ emissions by 123 million tonnes. This reduction equates to removing 62 million petrol and diesel cars from European roads for a year and would significantly contribute to the sector’s green transition. However, the article points out that aircraft innovation has stalled over the past decade, with no new models expected in the next ten years. Major manufacturers Airbus and Boeing dominate the market but have largely focused on incremental updates rather than disruptive
energyaviationgreen-technologydecarbonizationaircraft-innovationrenewable-energyhydrogen-aircraftAmple Brings Modular Battery Swapping Technology to Madrid with Support from the Spanish Government and the Moves Singulares Award - CleanTechnica
Ample has launched its first modular battery swapping stations in Madrid, supported by a €9.76 million grant from Spain’s Institute for the Diversification and Saving of Energy (IDAE). This funding, part of the Moves Singulares award initiative by the Spanish government, aims to accelerate the transition to electric mobility by expanding Ample’s battery swapping infrastructure in Madrid’s city center. The technology enables electric vehicles (EVs) to be fully charged in five minutes by swapping depleted batteries for fully charged ones, offering a fast and convenient alternative to traditional charging and addressing key barriers such as charging time, range anxiety, and infrastructure scalability. Madrid, which leads Spain in EV adoption, is targeting a 65% reduction in emissions by 2030 and supports the national goal of 5.5 million EVs on the road within the decade. Ample’s modular system, capable of rapid deployment in urban environments, is designed to integrate with any EV model and supports high-utilization fleets. The company is
energyelectric-vehiclesbattery-swappingmodular-technologyEV-charging-infrastructuresustainable-mobilitySpain-energy-policyPanasonic Develops a Cooling Water Circulation Pump for Data Centers — Promoting the Strategic Enhancement of the Pump Business - CleanTechnica
Panasonic’s Living Appliances and Solutions Company celebrated the 70th anniversary of its pump business in 2025, marking a significant milestone since its inception in 1955 with home well pumps. Over the decades, Panasonic has expanded its pump applications to include built-in pumps for water heaters, heating appliances, and bathroom equipment, contributing to energy efficiency and environmental friendliness. With cumulative shipments surpassing 53 million units, Panasonic pumps are widely used not only in its own products but also by various manufacturers globally. In response to the growing demand for efficient cooling solutions in data centers—especially driven by the rise of AI technologies and the increasing heat generated by CPUs and GPUs—Panasonic has developed a next-generation cooling water circulation pump tailored for data center cooling systems. This pump integrates advanced simulation technologies to improve performance by 75% (from 40 to 70 L/min) while maintaining a compact size suitable for installation within Coolant Distribution Units (CDUs). Key features include high efficiency, compact housing for
energydata-centerscooling-systemsliquid-coolingPanasonicpump-technologyenergy-efficiencyThe All-New Nissan LEAF Maximizes the EV Experience with Lifestyle Enhancing Tech - CleanTechnica
The all-new third-generation Nissan LEAF, unveiled in June 2025, introduces advanced technology designed to enhance the electric vehicle (EV) ownership experience and support everyday driving. A key feature is its intelligent route planner integrated with Google Automotive Services, which helps alleviate range anxiety by easily locating charging stations along routes. The LEAF also offers rapid charging capabilities, adding up to 250 km of range in just 14 minutes under optimal conditions, and supports North American Charging Standard (NACS) with Plug and Charge functionality in the U.S., streamlining the charging process. Beyond convenience, the LEAF incorporates smart battery management that adjusts cooling based on route conditions to optimize energy use, especially during demanding drives or fast charging in hot weather. It also features Vehicle-to-Load (V2L) connections, enabling owners to power devices up to 1500 watts for outdoor activities, and Vehicle-to-Home (V2H) functionality in markets like Japan, allowing the vehicle to supply electricity back to
energyelectric-vehiclesEV-chargingbattery-technologyvehicle-to-gridrenewable-energysmart-chargingEV Sales In China Continued Their Upward Climb In May - CleanTechnica
In May 2024, new energy vehicle (NEV) sales in China continued their strong upward trajectory, with total NEV market share reaching 48.7 percent of all new car sales—significantly above the 2024 average of 40.9 percent and marking the highest monthly share so far this year. This growth was driven by a 43 percent year-over-year increase in battery electric vehicle (BEV) sales, totaling 834,000 units, and a 27 percent rise in plug-in hybrid electric vehicle (PHEV) sales, which reached 473,000 units. Overall, the Chinese new car market sold 2.69 million vehicles in May, up 11.2 percent from the previous year. The data also highlighted that Chinese PHEVs tend to have much longer electric-only ranges compared to those commonly sold in the U.S., with some models offering over 150 miles on battery power alone. Significant price cuts—up to 34
energyelectric-vehiclesnew-energy-vehiclesbattery-electric-carsplug-in-hybridsChina-EV-marketclean-energy-transportationNo Wheels, No Deals: Why Aptera, Arcimoto & ElectraMeccanica Failed - CleanTechnica
The article from CleanTechnica critically examines the persistent failures of three-wheeled electric vehicle (EV) startups Aptera, Arcimoto, and ElectraMeccanica, highlighting fundamental flaws in their business models despite initial enthusiasm and media hype. Aptera, despite raising nearly $200 million over two decades and amassing tens of thousands of reservations, has yet to deliver a single vehicle. Its financial disclosures reveal severe losses and dwindling cash reserves, with no firm supplier agreements or production timeline, casting serious doubt on its viability. The company’s chronic underestimation of the capital needed to transition from prototype to production exemplifies the structural challenges these startups face. Arcimoto’s story is marked by overextension and financial distress, culminating in halted production, a plummeting stock price, and drastic operational cuts by early 2023. Although it avoided bankruptcy, the company’s lack of a clear recovery plan and inability to manage expenses against revenues have left it effectively dormant. ElectraMeccanica’s
energyelectric-vehiclesbattery-technologyclean-energyautomotive-startupssolar-powerelectric-mobilityHow Minor Metals Could Cause Major Electrification Bottlenecks - CleanTechnica
The article from CleanTechnica highlights a critical but often overlooked challenge in the global electrification transition: the supply constraints of minor or by-product metals such as indium, gallium, germanium, tellurium, selenium, and certain rare earth elements. Unlike primary metals like lithium and cobalt, whose production can be scaled more directly in response to demand, these by-product metals are produced only incidentally during the mining and refining of major metals like copper, zinc, nickel, and aluminum. This dependency means their supply is inherently tied to the extraction rates and market dynamics of unrelated primary metals, leading to unpredictable availability and price volatility that complicates strategic planning for industries reliant on these materials. Economically, the recovery of by-product metals is marginal and highly sensitive to market prices. For example, zinc refiners will only recover indium if its market price justifies the cost; otherwise, it remains in waste streams, causing intermittent shortages. This contrasts with primary metals, where steady demand typically supports sustained
energyelectrificationminor-metalssupply-chainrare-earth-elementsminingmaterialsAcid vapor lets CO2 capture tech run 4,500+ hours without failures
Researchers at Rice University have developed a simple yet effective modification to electrochemical carbon capture systems that dramatically extends their operational lifespan. By replacing the conventional water-based humidification of CO2 gas with mild acid vapors—such as hydrochloric, formic, or acetic acid—the team prevented the formation of potassium bicarbonate salt deposits that typically clog gas flow channels and flood electrodes. This acid vapor approach dissolves the problematic salts, allowing them to be carried away with the gas flow, thereby avoiding blockages that cause premature device failure. Testing showed that this acid-based humidification enabled stable operation for over 4,500 hours in a 100-square-centimeter electrolyzer—more than 50 times longer than the roughly 80 hours achievable with traditional water humidification. The method proved effective across various catalysts including silver, zinc oxide, copper oxide, and bismuth oxide, without causing significant membrane corrosion due to the low acid concentrations used. Because the modification requires only minor changes to existing humidification setups
energycarbon-captureCO2-reductionelectrochemical-systemscatalystsacid-vapormembrane-technologyTexans Love Their Wind Power, Even If Trump Doesn't - CleanTechnica
The article highlights the tension in Texas between the state's booming wind and solar energy sectors and the Republican-led legislative efforts to curb their growth. Despite Texas emerging as a national leader in renewable energy—surpassing California in gigawatt-hours generated from wind and solar in 2024—some Republican lawmakers, influenced by powerful anti-renewable advocacy groups like the Texas Public Policy Foundation, are pushing bills that could restrict landowners' rights to host renewable energy projects. These legislative moves threaten to undermine years of progress that have revitalized rural communities and provided significant tax revenue, even though most Texans support renewable energy development. The opposition to renewables in Texas is partly driven by political and ideological factors, including former President Donald Trump's well-documented disdain for wind power. Trump has repeatedly criticized wind turbines on aesthetic, economic, and environmental grounds, despite evidence contradicting his claims. This stance has influenced Texas Republicans, who appear to prioritize fossil fuel interests over the expanding clean energy sector. The article concludes by noting that
energywind-powerrenewable-energysolar-energyTexas-energy-policyclean-energyenergy-legislationOntario’s first Integrated Energy Plan builds on progress while failing to address security and affordability concerns of natural gas - Clean Energy Canada
Ontario’s first Integrated Energy Plan, released recently, advances the province’s leadership in modernizing its electricity system by emphasizing distributed energy resources (such as battery storage, rooftop solar, and smart EV charging) and energy efficiency. These initiatives are seen as positive steps that can help address cost-of-living challenges and serve as a model for other Canadian jurisdictions. The plan also initiates an integrated energy planning process, which is a significant development for the province’s energy strategy. However, the plan has notable shortcomings, particularly regarding natural gas. While it sets broad goals around affordability, security, reliability, and clean energy, it lacks specific targets or metrics to measure progress. Independent modeling accompanying the plan highlights risks associated with continued reliance on natural gas, especially for household energy affordability. Contrary to these findings, the plan proposes expanding natural gas use in electricity and distribution systems, which could undermine potential consumer savings from electrification and clean technologies. Thus, despite the plan’s strengths, significant concerns remain about its ability to meet
energyintegrated-energy-planclean-energynatural-gaselectricity-system-modernizationenergy-efficiencydistributed-energy-resourcesUK logs record $3.4B for world's first prototype nuclear fusion plant
The UK government has committed a record £2.5 billion ($3.4 billion) to develop the world’s first prototype nuclear fusion power plant, known as STEP (Spherical Tokamak for Energy Production). This ambitious project will be constructed on the site of the former West Burton A coal power station in Nottinghamshire, marking a significant transition from fossil fuels to clean, futuristic energy technology. STEP aims to replicate the sun’s fusion process by heating hydrogen isotopes to 150 million degrees Celsius and confining them with powerful magnetic fields to generate carbon-free electricity. The initiative is central to the UK’s strategy to become a “clean energy superpower” and is expected to create over 10,000 jobs in the region, spanning construction through to operations. This investment reflects a broader global trend of substantial funding in nuclear fusion technology from governments and corporations alike. For example, Google has recently invested in TAE Technologies, which announced a breakthrough in fusion reactor readiness, while US scientists secured $2.3
energynuclear-fusionclean-energyfusion-power-plantUK-energy-investmentrenewable-energyenergy-technologyHyundai Motor Teases the All-New IONIQ 6 N, Providing Glimpse of N’s Upcoming High-Performance EV - CleanTechnica
Hyundai Motor Company has released teaser images of the all-new IONIQ 6 N, its upcoming high-performance electric sedan that builds on the success of the IONIQ 5 N. The IONIQ 6 N features a streamlined silhouette with advanced aerodynamics, including flared fenders, a wider stance, lightweight wheels, and a large wing spoiler, all designed to enhance high-speed stability and dynamic capability. The vehicle embodies Hyundai N’s three core performance pillars: Corner Rascal, Racetrack Capability, and Everyday Sports Car, aiming to deliver an exhilarating and intuitive driving experience. The IONIQ 6 N represents Hyundai’s continued commitment to innovation in high-performance electric vehicles, combining cutting-edge design with groundbreaking technology. Hyundai chose to debut the IONIQ 6 N at the Goodwood Festival of Speed to engage closely with fans and showcase its disruptive potential in the high-performance EV segment. This model is positioned to further Hyundai’s legacy of motorsport success and industry accolades, reinforcing
energyelectric-vehiclesHyundaiIONIQ-6-Nhigh-performance-EVaerodynamicsautomotive-innovationTexas Approves Use Of Fracking Wastewater To Irrigate Crops - CleanTechnica
The article discusses the controversial approval by Texas to use treated fracking wastewater for irrigating crops, raising significant health and environmental concerns. Fracking involves injecting water mixed with various toxic chemicals—many of which are trade secrets—into underground rock formations to extract oil and methane. This wastewater contains harmful substances, including undisclosed organic surfactants, which are chemicals that help mix oil and water but may pose risks to human health. The secrecy around the exact chemical composition prevents communities and regulators from fully understanding the potential dangers, as exemplified by a Chevron well blowout in Colorado that exposed nearby schoolchildren to unknown contaminants. Proponents in Texas argue that recycling fracking wastewater could alleviate the state's fresh water scarcity and encourage the oil and gas industry to manage their waste more responsibly. However, critics highlight the risks of introducing toxic substances into agricultural irrigation, potentially contaminating crops and the food supply. The article also references a public stunt by a fracking company executive who drank fracking water to claim its safety,
energyfrackingwastewaterirrigationpetroleumsurfactantsenvironmental-impactNew XPENG G6 & G9 Come To Europe - CleanTechnica
XPENG has launched its new G6 and G9 "ultra smart" electric SUVs in Europe as part of its effort to expand sales on the continent. Both models feature advanced 800V architecture and a 5C "supercharging battery" enabling rapid charging from 10% to 80% in just 12 minutes. The premium G9 SUV supports a peak charge rate of 525 kW, while the G6 SUV coupe reaches 451 kW, positioning them as class leaders in charging speed. Orders open mid-July, with customer interest already being accepted in several European countries including the Netherlands, Norway, and France. A key innovation in both models is the use of next-generation 5C lithium iron phosphate (LFP) batteries across all trims, which enhance safety and sustainability by eliminating cobalt and nickel without sacrificing performance. The vehicles also incorporate a fully upgraded intelligent driving suite featuring a MicroFiber capacitance steering wheel, an advanced driving chip, and single-pixel Lof
energyelectric-vehicleslithium-iron-phosphate-batteriesbattery-technologysuperchargingsustainable-materialssmart-mobilityElectrification Won’t Crash On Copper: Debunking Latest Claims - CleanTechnica
The April 2025 paper by Cathles et al., which has gained traction in industry and policy discussions, claims that global copper supply will severely constrain electrification and renewable energy deployment. However, this CleanTechnica article critically examines these assertions and finds them significantly flawed. The paper overestimates copper requirements for energy storage by at least a factor of 100 and also inflates copper needs for electric vehicles (EVs). It neglects important factors such as copper substitution with aluminum and other materials, the rise of zero-copper sodium-ion batteries, and underestimates the impact of copper recycling. Consequently, its conclusions about copper shortages and the need for extensive new mining are deemed not credible. Specifically, the authors assume an unrealistically high copper content of 80 kg per EV, whereas industry trends and innovations suggest much lower usage—potentially as low as 20 to 30 kg per vehicle. Advances such as higher-voltage architectures (800V+), aluminum wiring (already used by
energycopperelectric-vehiclesbattery-technologyrenewable-energymaterials-innovationelectric-motor-designMeta teams with XGS Energy to build a 150 MW geothermal power plant
Meta has partnered with startup XGS Energy to develop a 150 megawatt geothermal power plant in New Mexico, marking the tech giant’s growing interest in geothermal energy as a clean, reliable power source. While specific details about the plant’s location and the terms of the deal remain undisclosed, Meta clarified that the agreement is aimed at advancing geothermal development rather than a direct power purchase contract. This move aligns with a broader trend among tech companies and data center operators who are increasingly exploring geothermal energy due to its ability to provide continuous, emission-free electricity. XGS Energy differentiates itself with a closed-loop geothermal system that circulates water within a sealed well, minimizing water loss, and uses a proprietary mud to enhance heat transfer from surrounding rocks. This technology contrasts with more common open-loop designs that lose some water to the ground over time. The partnership reflects growing momentum in the geothermal sector, with other startups like Fervo Energy securing significant financing to build large-scale plants and companies such as Google investing in geothermal
energygeothermal-energyrenewable-energyMetaXGS-Energypower-plantsustainable-technologyGecko Robotics reaches unicorn status with latest funding
Gecko Robotics, a Pittsburgh-based company specializing in robotic technology for critical infrastructure, has reached unicorn status following a $125 million Series D funding round that doubled its valuation to $1.25 billion. The new capital will fuel the company’s expansion and focus on sectors such as defense, energy, and manufacturing—areas increasingly prioritized by governments and corporations. Recent strategic partnerships include collaborations with NAES to modernize the energy sector, L3Harris on an Extended Reality product, and ongoing work with the Abu Dhabi National Oil Company. Gecko’s CEO, Jake Loosararian, highlighted the company’s AI-powered operating platform, Cantilever, which ensures data integrity and enables advanced diagnostics and modernization of physical infrastructure worldwide. Gecko Robotics employs a variety of robots capable of climbing, flying, and swimming to collect high-fidelity data on complex built environments, including U.S. Navy warships and power plants. Cantilever’s AI-driven decision-making framework can predict infrastructure failures, optimize operations, and improve efficiency
robotAIcritical-infrastructureenergyindustrial-automationrobotics-technologyinfrastructure-maintenanceVolvo Cars to Use Recycled Steel in Next EV - CleanTechnica
Volvo Cars is advancing its sustainability efforts by committing to use high-quality, recycled, and near zero-emissions steel supplied by SSAB starting in 2025. This makes Volvo the first automaker to secure such a deal for mass-produced vehicles. The recycled steel will initially be incorporated into the upcoming fully electric Volvo EX60 SUV and future SPA3 architecture models. Volvo emphasizes that this recycled steel meets the same stringent safety and durability standards as traditional steel, aligning with its reputation for safety and environmental responsibility. The move is part of Volvo’s broader strategy to reduce its carbon footprint, as steel production accounts for about 25% of material-related emissions in its cars. The company aims to cut average CO2 emissions of its vehicles by 65–75% by 2030 compared to 2018 levels and achieve net-zero greenhouse gas emissions by 2040. Volvo also plans for an average of 30% recycled content across its fleet by 2030, with new models from that year containing
energymaterialsrecycled-steelelectric-vehiclessustainabilitycircular-economyVolvo-CarsBattery manufacturer Powin files for bankruptcy months after landing $200M loan
Powin, an Oregon-based battery manufacturer specializing in grid-scale lithium-iron-phosphate (LFP) batteries primarily sourced from China, filed for Chapter 11 bankruptcy on June 12, 2025. The company disclosed it has over $300 million in debt but will continue operations while restructuring. Powin recently laid off nearly 250 employees, retaining only 85, and replaced former CEO Jeff Waters with Brian Krane, the chief projects officer. Despite securing $200 million in financing from KKR and previously receiving growth equity from investors like Energy Impact Partners, GIC, and Trilantic Energy Partners, Powin struggled financially, possibly due to tariffs impacting its reliance on Chinese battery cells. Founded during the first clean tech boom over a decade ago, Powin had grown significantly alongside the surge in grid-scale battery storage, ranking fourth worldwide in installed capacity. The bankruptcy filing did not specify the exact causes of the debt increase, but supply chain challenges and tariff pressures are implied factors. The restructuring under
energybattery-technologygrid-scale-storagelithium-iron-phosphateclean-techenergy-storagePowin-bankruptcyUS scientists build ‘fog guitar’ that strums water from thin air
Researchers at Virginia Tech have developed an innovative atmospheric water harvesting device called the "fog guitar," which significantly improves upon traditional fog collection methods. Traditional fog nets, used for centuries, suffer from design limitations such as clogging due to small holes and inefficiency from large holes letting droplets pass through. In 2018, the team introduced the "fog harp," which replaced horizontal wires with vertical fibers to increase water collection efficiency by two to seven times. However, the fog harp faced a critical issue: under heavy fog, surface tension caused the vertical fibers to tangle and clump, reducing performance when water was most abundant. To solve this, the researchers created hybrid "fog guitar" designs that reintroduced a limited number of horizontal supports—akin to guitar frets—to prevent fiber tangling while avoiding clogging. By testing seven variations with different numbers of these "frets," they identified an optimal configuration that balances the prevention of tangling and clogging, maximizing water collection efficiency even in dense fog.
energywater-harvestingsustainable-technologyatmospheric-water-collectionfog-harvestinghybrid-designVirginia-Tech-researchSecret SONGBOW: World-first 400kW laser from US to fry drones in blink
The US Navy has initiated the highly classified SONGBOW program to develop a groundbreaking 400-kilowatt laser weapon system capable of destroying drones, missiles, and other aerial threats mid-air. The Department of Defense awarded a $29.9 million contract to Coherent Aerospace & Defense to design, integrate, and test this advanced directed-energy subsystem for deployment on naval vessels and potentially land platforms. The system will combine multiple 50-kilowatt laser modules into a single, high-powered beam with precision beam control, enabling higher power output without sacrificing accuracy or beam quality. This represents a significant advancement compared to existing naval laser systems, which typically operate between 30 and 100 kilowatts. The SONGBOW laser aims to enhance the Navy’s layered defense strategy by providing a rapid, cost-effective response to evolving threats such as drone swarms and hypersonic missiles, which can overwhelm traditional missile defenses like the Aegis Combat System. Coherent Aerospace & Defense, experienced in high-energy lasers and
energydirected-energy-weaponslaser-technologymilitary-technologydefense-systemshigh-power-lasersfiber-lasersStartup Sneaks More Solar Energy Into The Grid
The article highlights a Virginia-based startup, Earthrise, which is advancing the US solar energy sector despite federal policy challenges posed by the “Big Beautiful Bill” that includes provisions unfavorable to renewables. Earthrise recently secured financing for the 270-megawatt Gibson City Solar project in Illinois, notable for its size amid growing local opposition to solar developments. The project’s financing is unique, involving a “first-of-its-kind” tax equity and debt deal coordinated by major international banks BBVA, Intesa Sanpaolo, and NORD/LB, alongside a tax equity commitment from a Fortune 500 telecommunications company. This deal also leverages a new Indexed Renewable Energy Credit offtake agreement authorized by the Illinois Power Agency, signaling innovative state-level support for solar. What sets Earthrise apart is its strategic business model of acquiring existing gas peaker plants and their grid interconnections—totaling about 1.7 gigawatts—and repurposing these connections for solar projects, including over
energysolar-energyrenewable-energysolar-power-plantenergy-financingdecarbonizationclean-energyWorld’s 5th most efficient supercomputer runs 100% on green energy
Paderborn University’s new supercomputer, Otus, has achieved the rank of fifth most energy-efficient supercomputer globally on the Green 500 list, which benchmarks high-performance computing systems based on energy efficiency rather than raw speed. Otus, developed by Lenovo and pro-com Datensysteme GmbH, features 142,656 processor cores, 108 GPUs, AMD’s latest ‘Turin’ processors, and a five-petabyte IBM Spectrum Scale file system. It operates entirely on renewable energy, uses indirect free cooling for year-round efficiency, and repurposes its exhaust heat to warm buildings, underscoring its sustainability credentials. The supercomputer is expected to be fully operational by the third quarter of 2025. Otus nearly doubles the computing power of its predecessor, Noctua, enabling it to handle a wide range of CPU-intensive tasks such as atomic simulations and quantum computing. Its expandable architecture supports up to 100 field-programmable gate arrays (FPGAs),
energysupercomputergreen-energyhigh-performance-computingrenewable-energyenergy-efficiencysustainable-technologyToyota’s new hypercar runs on liquid hydrogen, debuts at Le Mans
Toyota has unveiled its new hydrogen-powered hypercar, the GR LH2 Racing Concept, at the 24 Hours of Le Mans, signaling a significant advancement in hydrogen combustion technology for motorsport. Building on last year’s GR H2 Concept, the GR LH2 features a hybrid powertrain that combines hydrogen combustion with electric hybrid technology, likely sharing design elements with the successful GR010 Hybrid racecar. The vehicle sports a more aggressive aerodynamic design, including smaller LED headlights, redesigned side intakes, a taller rear wing, and a pronounced fin, while maintaining a similar greenhouse to the GR010. Measuring 5,100 mm long and 2,050 mm wide, the GR LH2 aims to deliver strong track performance and demonstrate hydrogen’s viability in endurance racing. This new hypercar is part of Toyota’s broader “multi-pathway” strategy toward a carbon-neutral future, which includes battery-electric vehicles, hybrids, carbon-neutral fuels, and hydrogen-powered systems. Toyota’s continued investment in hydrogen technology extends beyond
energyhydrogen-fuelhybrid-powertrainToyotahydrogen-combustioncarbon-neutralautomotive-technologySouth Korea turns plastic bottles into hydrogen with solar power
Scientists at South Korea’s Institute for Basic Science (IBS) Center for Nanoparticle Research, led by Professors Kim Dae-Hyeong and Hyeon Taeghwan, have developed an innovative photocatalytic system that converts plastic waste, specifically PET bottles, into clean hydrogen fuel using sunlight. This system addresses the inefficiencies and greenhouse gas emissions associated with conventional hydrogen production methods by harnessing solar energy to break down plastics into byproducts like ethylene glycol and terephthalic acid while releasing hydrogen. A key advancement is the stabilization of the catalyst within a polymer network at the air-water interface, which prevents common issues such as catalyst loss and reverse reactions, enabling stable operation for over two months even in harsh alkaline conditions. The technology was successfully tested outdoors with a one-square-meter device that produced hydrogen from dissolved plastic bottles under natural sunlight. Its floatable catalyst design allows it to function in various water environments, including seawater and tap water. Importantly, simulations indicate the system can
energyclean-energyhydrogen-productionphotocatalysisplastic-recyclingsolar-powersustainable-technologyRenault unveils drone-launching rescue EV to save lives in disasters
Renault has unveiled the vision4rescue, an innovative electric rescue vehicle concept based on the Renault 4 E-Tech platform, designed specifically for emergency services operating in disaster zones and rough terrain. Developed in collaboration with Software République and input from fire services across 19 countries, the vehicle functions as a mobile command center equipped with nearly 20 interconnected technologies to facilitate real-time coordination, data analysis, and communication during crises. Its rugged design features all-wheel drive, increased ground clearance, and protective elements to navigate challenging environments, while distinctive emergency graphics enhance visibility. A key highlight of the vision4rescue is its rooftop aerodynamic capsule housing a surveillance drone and communication tools that can restore local networks after natural disasters, effectively serving as an aerial assessment and digital communication hub. The interior is tailored for frontline use, featuring custom seats made from recycled firefighter suit foam, a metal dashboard bar for essential tools, dual screens for data sharing, and smart storage solutions to keep equipment charged and accessible. This zero-emission vehicle
robotIoTenergyelectric-vehicledrone-technologyemergency-responsesmart-mobilityCERN cools giant 20-ton magnets at -456°F for 10x particle collision
CERN is nearing completion of a critical test facility for the High-Luminosity Large Hadron Collider (HL-LHC), an upgrade designed to increase the accelerator’s luminosity—the number of particle collisions—by a factor of ten. The facility includes a 95-meter-long test stand replicating new magnet segments weighing between 10 and 20 tons, which must operate at an ultra-cold temperature of -456°F (-271°C) using superfluid helium to achieve superconductivity. These advanced magnets, made from a novel niobium-tin alloy, can generate magnetic fields of 11.3 tesla, significantly stronger than the current 8.3-tesla magnets, enabling denser particle beams and more precise collision experiments. The test stand, known as the “IT String,” serves as a full-scale rehearsal to validate the integration and performance of these components under extreme conditions before installation in the main LHC tunnel. This phase involves managing complex electrical circuits carrying over 100,
energysuperconducting-magnetsparticle-acceleratorniobium-tin-alloycryogenicsLarge-Hadron-Colliderhigh-luminosity-upgradeHelix reveals new aircraft design that cuts flight fuel use by 90%
Helix, a UK-based electric motor specialist, has unveiled a radical aircraft design aimed at cutting fuel consumption on very short-haul flights (under 250 nautical miles) by up to 90 percent. Their new blueprint, detailed in the white paper “A New Architecture for Aviation,” proposes a three-step redesign for regional and private aircraft that combines a hybrid electric system, lightweight high-density motors, and ducted fan propulsion. This approach reduces fuel burn from around 230 kg per flight to just 23.8 kg, offering a practical path to significantly lower emissions and operating costs using existing technology. The design targets a market segment that accounts for over a quarter of global air traffic and faces high fuel costs, especially as sustainable aviation fuels (SAFs) become more expensive. Helix’s solution centers on series hybridization, which pairs a compact liquid-fuel generator with batteries, enabling electric-only operation during critical phases like takeoff and landing, and fuel-powered battery recharging during cruise. This hybrid
energyhybrid-electric-aircraftfuel-efficiencyaviation-technologysustainable-aviation-fuelselectric-motorsshort-haul-flightsCall Upon the French, Spanish, and Portuguese Governments to Improve Cross-Border Rail Connections - CleanTechnica
The article from CleanTechnica highlights a call from global and Iberian business travel associations, along with the logistics company Transfesa, urging the French, Spanish, and Portuguese governments to improve and complete key cross-border rail connections. The focus is on enhancing international train links between these countries to facilitate more sustainable travel options. Traveling by train instead of flying can reduce emissions by over 90% on certain routes, making rail a significantly greener alternative for business travel. However, the current lack of competitive and efficient international rail connections between France, Spain, and Portugal hampers efforts by businesses to reduce their carbon footprint by choosing trains over planes. The article emphasizes that better rail infrastructure and services are essential to support the shift toward less polluting transportation modes, thereby contributing to broader environmental goals. The piece also includes a brief mention of CleanTechnica’s newsletters and community engagement but primarily centers on the environmental and logistical benefits of improved cross-border rail travel in the Iberian region.
energytransportationsustainable-travelelectric-trainsemissions-reductioncross-border-railclean-technologyPowering Data: NREL Partner Forum Puts Everything on the Table - CleanTechnica
The 2025 NREL Partner Forum convened over 300 stakeholders in Golden, Colorado, to address the rapidly growing energy demands of U.S. data centers, which have tripled over the past decade and doubled in the last two years. Hosted by the National Renewable Energy Laboratory (NREL), the event emphasized collaboration among utilities, companies, governments, and communities to strategize how to power data centers sustainably and efficiently. Key themes included the need for data centers to become active participants in grid management, the importance of siting data centers near power sources rather than moving power to them, and the necessity of community involvement in planning. Keynote speaker Dean Nelson highlighted the complexity of balancing social, economic, ecological, and community priorities amid the surging instantaneous power demands of modern data centers, driven by advances in chip design that increase power consumption density. Panelists, including Mason Emnett of Constellation Energy, stressed that competition over energy resources creates regulatory friction, advocating instead for collaborative approaches that consider
energydata-centersgrid-integrationrenewable-energypower-managementNRELenergy-demandRoam Launches The Second Generation of Its Roam Air Electric Motorcycle In Kenya - CleanTechnica
Roam, a leading Kenyan electric motorcycle startup, has launched the second generation of its Roam Air electric motorcycle, designed specifically with input from boda boda riders—the motorcycle taxi operators who form a critical part of Kenya’s economy, supporting around 5 million livelihoods. The new Roam Air Gen 2 features over 40 practical improvements based on real user feedback from the first generation, including a lighter frame by one kilogram for better battery efficiency and handling, a reinforced frame supporting up to 240 kilograms (20 kg more than before), and a lockable single-door battery compartment to reduce theft and simplify battery swapping. These enhancements aim to meet the rigorous demands of daily transport across Kenya’s varied road conditions. The electric motorcycle sector in Africa is rapidly growing, driven largely by private startups like Roam, amid broader regional shifts toward electric vehicles. In Kenya, electric motorcycles accounted for 7.1% of new motorcycle registrations in 2024, reflecting increasing adoption. This growth is significant given that nearly
electric-motorcycleselectric-vehiclesenergyelectric-mobilitysustainable-transportationAfrica-electric-vehiclesRoam-Air-Gen-2Benzene: The Toxic Chemical in Both Gas Stoves & Cigarette Smoke - CleanTechnica
A 2023 study published in Environmental Science and Technology revealed that gas stoves emit benzene, a known carcinogen, at levels often exceeding those found in secondhand cigarette smoke. Benzene, recognized as a cancer-causing chemical by the IARC and EPA, can linger indoors for hours after cooking with gas stoves, posing significant health risks. In contrast, induction stoves produce no detectable benzene, and electric coil stoves emit minimal amounts. The study compared air quality in homes using gas versus electric stoves across California and Colorado, highlighting the dangers of indoor natural gas combustion. Further research from Stanford University in 2025 emphasized the heightened cancer risk for children exposed to benzene from gas stoves, especially in poorly ventilated homes. Benzene accumulates not only in kitchens but also spreads to bedrooms and living areas, increasing lifetime cancer risk nearly twofold for children. To mitigate exposure, experts recommend switching to electric or induction stoves, ensuring proper ventilation by opening windows during cooking
energynatural-gasindoor-air-qualitybenzenegas-stovesair-pollutionhealth-risksDid California Break the Law While Cutting Rooftop Solar Subsidies - CleanTechnica
California, long a leader in rooftop solar installations due to its net metering policy that credited solar panel owners at retail electricity rates, replaced this system with "Net Metering 3.0" on April 15, 2024. This change followed years of pressure from investor-owned utilities—Southern California Edison, Pacific Gas & Electric, and San Diego Gas & Electric—who argued that compensating solar owners at retail rates unfairly shifted costs to non-solar ratepayers. The new policy significantly reduced these subsidies. However, environmental groups including the Center for Biological Diversity, the Environmental Working Group, and the Protect Our Communities Foundation have sued the California Public Utilities Commission (CPUC), claiming it failed to consider the full range of financial and societal benefits of rooftop solar. These benefits include reduced grid infrastructure costs (such as transmission lines and substations), improved grid security and resiliency, health and climate advantages, and the use of existing rooftop space rather than new land. The plaintiffs argue that by
energysolar-powerrooftop-solarnet-meteringCalifornia-energy-policyrenewable-energygrid-resiliencyAlberta's Renewable Energy Sabotage: Time For Federal Intervention - CleanTechnica
The article highlights Alberta’s newly introduced reclamation security requirements for renewable energy projects, set to take effect by May 31, 2025, which are described as unprecedentedly severe and punitive. Developers must post securities equal to 30% of anticipated decommissioning costs at project start, increasing to 60% after 15 years, with these rules applied retroactively to existing projects by 2027. The exclusion of salvage value from these calculations inflates financial burdens well beyond international norms, making Alberta’s requirements the highest globally. This regulatory shift contrasts sharply with Alberta’s historically lax reclamation policies for fossil fuel industries, which have accumulated tens of billions in unfunded cleanup liabilities with minimal upfront financial assurances, effectively shifting cleanup costs to taxpayers. The article argues that this move represents a politically motivated, ideologically driven attack on the renewable energy sector, undermining investor confidence by breaking contractual norms through retroactive application of harsh financial obligations. Such instability threatens to halt billions in investments and push companies to relocate
energyrenewable-energyAlbertaenergy-policyenvironmental-regulationfossil-fuelsinvestment-risksSolar Orbiter captures first-ever images of sun’s south pole
The Solar Orbiter spacecraft, a joint mission by the European Space Agency (ESA) and NASA, has captured humanity’s first-ever images of the sun’s south pole by maneuvering 15 degrees below the solar equator. These unprecedented ultraviolet images reveal the sun’s chaotic magnetic south pole, providing critical insights into the sun’s 11-year magnetic polarity flip cycle. Unlike Earth’s stable magnetic poles, the sun’s magnetic field reverses approximately every 11 years, a process linked to solar maximum periods marked by intense sunspots and solar flares. The Solar Orbiter’s observations confirm a long-predicted but previously unseen fragmented magnetic mosaic of mixed north and south polarities at the sun’s base, crucial for understanding and forecasting solar activity. The sun’s uneven rotational speed—faster at the equator than at the poles—twists its magnetic field until it snaps and reverses polarity, driving the solar cycle’s dynamic behavior. As the sun approaches its next solar minimum in about five years
energysolar-energyspace-explorationmagnetic-fieldsolar-cycleSolar-Orbitersun's-south-poleDairy digesters slash methane emissions by 80% on California farm
A recent University of California, Riverside study demonstrates that sealed dairy digesters can reduce methane emissions from manure by approximately 80% on a California dairy farm. Methane, a greenhouse gas over 80 times more potent than carbon dioxide over 20 years, is a significant contributor to global warming, with California dairy farms being major sources due to manure management. The study involved detailed atmospheric methane measurements before and after installing a digester at a Tulare County family-run dairy, revealing substantial emission reductions after addressing initial system leaks through collaboration between scientists, the system operator, and the farmer. Dairy digesters work by covering manure pits with gas-tight membranes that trap methane produced during anaerobic decomposition. The captured methane is then cleaned and repurposed as fuel, often powering trucks that would otherwise use diesel. While highly effective, digesters have limitations: they can leak if not properly maintained, do not reduce other pollutants like ammonia or fine particles, and require significant investment and regulatory permits, making them less feasible
energymethane-emissionsdairy-digestersrenewable-energygreenhouse-gas-reductionbioenergysustainable-agricultureBrazil EV Sales Report: Local EV Production Imminent as Sales Reach a New Record in May - CleanTechnica
Brazil’s electric vehicle (EV) market reached a new milestone in May 2025, with over 14,000 EVs sold—a record high and a 63% year-on-year increase. This growth has been consistent throughout the year, surpassing previous peak sales months like December 2024. The Brazilian market is preparing for local EV production, with BYD and Great Wall Motors (GWM) set to start manufacturing the Dolphin Mini and Haval H6 models in July at their respective factories. Notably, Brazil shows a distinct preference for plug-in hybrid electric vehicles (PHEVs) over battery electric vehicles (BEVs), with PHEV sales growing 104% in May compared to 35% for BEVs. May’s sales figures nearly balanced the two powertrains, with BEVs at 48% and PHEVs at 52%, marking a recovery for BEVs after a period of decline. BYD dominates the Brazilian EV market with a 64%
energyelectric-vehiclesEV-marketBrazilbattery-technologyplug-in-hybridsautomotive-industrySmaller, Lighter, Cheaper Electric Van From Volkswagen In Development - CleanTechnica
Volkswagen is developing a smaller, lighter, and more affordable electric multipurpose vehicle (MPV) that could serve as a practical family alternative to larger, less efficient SUVs like the ID. Buzz. While the ID. Buzz generated significant excitement due to its nostalgic connection to the original Volkswagen bus, its high price—$72,385 for the US First Edition—has limited its market success, particularly in the US. The ID. Buzz has found moderate success in Europe, primarily as a commercial and taxi vehicle, benefiting from its compact size suited for congested city environments. The new electric MPV concept draws inspiration from earlier Volkswagen prototypes such as the 2016 Budd-e, which featured a large battery and promising range for its time. Volkswagen is revisiting these MPV designs to create a vehicle with a smaller footprint, lighter weight, and more affordable price point than the ID. Buzz, targeting family buyers who want a practical, high-utility electric vehicle. Key design features under consideration include
energyelectric-vehiclesVolkswagenID.Buzzbattery-technologyclean-transportationMPVKorean team develops platinum-free hydrogen electrolysis system
A research team from KAIST, led by Professor Hee-Tak Kim in collaboration with Dr. Gisu Doo from the Korea Institute of Energy Research, has developed a platinum-free proton exchange membrane water electrolysis (PEMWE) system that maintains high performance while significantly reducing costs. PEMWE is a promising technology for producing high-purity hydrogen using water and electricity, but its reliance on expensive metals like platinum and iridium has limited widespread adoption. The team identified that poor electron transport in PEMWE cells stems from a “pinch-off” effect at the interface where the iridium oxide (IrOx) catalyst, ionomer, and titanium substrate meet, with the ionomer acting as an electrical insulator and creating a conductivity barrier. To address this, the researchers focused on increasing the size of the IrOx catalyst particles, discovering that particles larger than 20 nanometers reduced pinch-off zones and improved electron flow without the need for platinum. Additionally, they optimized the catalyst layer structure to minimize
energyhydrogen-electrolysisclean-energyPEMWEcatalyst-designplatinum-free-technologyKAIST-researchThe EPA Wants to Roll Back Emissions Controls on Power Plants
The US Environmental Protection Agency (EPA) has proposed rolling back emissions standards for power plants, which are the second-largest source of CO2 emissions in the country. This move comes shortly after NOAA reported record-high seasonal CO2 concentrations. EPA Administrator Lee Zeldin criticized previous administrations for prioritizing environmental regulations over economic growth, emphasizing the agency’s intention to support domestic fossil fuel industries, including coal, which has been in decline due to competition from natural gas and renewables. The proposed rollbacks would weaken Biden-era rules that required coal- and gas-fired power plants to reduce emissions by 90% by the early 2030s, primarily through carbon capture and storage technology. The EPA’s justification for the rollbacks includes the argument that US power sector emissions represent a small fraction (3%) of global emissions, and that continued coal use abroad diminishes the impact of US regulations on global greenhouse gas levels. However, critics highlight that the US power sector remains a major domestic polluter, ranking second only
energyEPApower-plantsemissionscarbon-capturefossil-fuelsclimate-policyEVs At 28.5% Share In Germany - Volkswagen Group Takes Half Of All BEVs - CleanTechnica
In May 2025, plugin electric vehicles (EVs) achieved a 28.5% market share in Germany, a significant increase from 18.5% a year earlier. Battery electric vehicles (BEVs) accounted for 18.0% of sales, while plug-in hybrids (PHEVs) made up 10.5%. Year-to-date, plugin EVs hold a 27.4% share, up from 18.3% in 2024, reflecting a steady transition toward electrification in the German auto market. Volkswagen Group played a pivotal role in this growth, doubling its BEV volumes year-on-year in May and contributing 82% of the BEV sales increase, while capturing half of all BEV sales that month. This surge has helped plugin vehicles surpass petrol-only cars in market share for three consecutive months, with hybrids (HEV and MHEV) also maintaining strong presence but showing signs of plateauing. The Volkswagen ID.7 was
energyelectric-vehiclesBEVPHEVVolkswagenautomotive-marketclean-transportationFervo Energy lands $206M in financing to build massive geothermal power plant
Fervo Energy, a leading geothermal startup, has secured $206 million in financing to advance the development of Cape Station, poised to be the world’s largest enhanced geothermal power plant located in Utah. The project’s initial phase is expected to begin operations next year, generating 100 megawatts of electricity, with a planned expansion in 2028 adding an additional 400 megawatts. Enhanced geothermal technology, which accesses deeper and hotter underground heat than traditional methods, offers a promising, emissions-free, and continuous power source, particularly appealing for energy-intensive applications like AI data centers. The technology also benefits from expertise derived from the oil and gas industry, potentially aiding its regulatory and political support. The financing package includes $100 million in preferred equity from Breakthrough Energy Catalyst, Bill Gates’s investment arm, an additional $60 million loan from Mercuria, and $45.6 million in bridge debt from X-Caliber Rural Capital. This funding follows Fervo’s recent achievement of drilling its hottest and deepest
energygeothermal-energyrenewable-energypower-plantclean-energyenergy-financingsustainable-energyFrance’s €520/Ton CO₂ Problem: Hydrogen Is Too Expensive For Transport - CleanTechnica
The article discusses the findings of a French audit on the economics of decarbonized hydrogen production via electrolysis, revealing that the cost of avoiding CO₂ emissions through this method is approximately €520 per ton. This figure far exceeds typical societal costs for CO₂ reduction technologies, highlighting that electrolytic hydrogen remains economically unviable without substantial public subsidies. France’s National Hydrogen Strategy (SNH2), launched in April 2025, aims to rapidly expand electrolytic hydrogen production with over €9 billion allocated for this purpose. However, the Cour des comptes report underscores that even optimistic assumptions about energy prices do not significantly improve the economic outlook, and the reported €9 billion in subsidies likely underestimates the true financial burden due to unaccounted infrastructure costs and indirect subsidies. The audit also reveals a complex web of overlapping subsidies that effectively lower the cost burden for hydrogen producers. These include mechanisms like the European Emissions Trading Scheme (ETS), which, by increasing carbon costs for fossil-fuel-based hydrogen
energyhydrogendecarbonizationelectrolyzersrenewable-energypublic-subsidiesCO2-reductionAurora nuclear reactor may run US base for 10 years without refueling
Oklo has received a Notice of Intent to Award from the Defense Logistics Agency Energy to deploy its Aurora nuclear microreactor at Eielson Air Force Base (AFB) in Alaska. This marks the first formal US military project to adopt a commercial fast microreactor, aiming to enhance energy independence and operational security for defense infrastructure, particularly in remote or unstable environments. The Aurora reactor is designed to operate autonomously for up to 10 years without refueling, using recycled high-assay low-enriched uranium (HALEU) fuel, which reduces nuclear waste and supports long-term, reliable power supply. Its liquid-metal-cooled fast reactor technology offers safety and efficiency advantages over traditional reactors, including a compact core and no need for pressurization. Eielson AFB, home to the 354th Fighter Wing and F-35A aircraft, faces logistical challenges due to its remote sub-Arctic location. The Aurora’s modular design and long fuel cycle will reduce dependence on vulnerable fuel supply
energynuclear-reactormicroreactormilitary-energy-resilienceautonomous-powersmall-modular-reactorsustainable-energyNew Mexico Offers $5.3M In Low-Interest Loans For Energy-Saving Building Upgrades - CleanTechnica
New Mexico has launched a $5.3 million Energy Efficiency Revolving Loan Fund (EERLF) to provide low-interest loans for energy-saving upgrades in nonprofit, community-serving buildings such as clinics, schools, museums, and recreation centers. Managed by the New Mexico Energy, Minerals and Natural Resources Department (EMNRD), the fund offers loans ranging from $250,000 to $1 million at a fixed 2% interest rate, with terms up to 15 years. Eligible projects include HVAC improvements, insulation, lighting upgrades, energy audits, and related efficiency measures; standalone solar panel installations are excluded unless part of a broader energy overhaul. Applicants must complete a thorough commercial energy audit meeting specific criteria to identify peak energy demand and recommend cost-saving controls. After audit approval, organizations submit loan applications to the New Mexico Finance Authority (NMFA) for underwriting and approval. Borrowers are required to contribute at least 5% of project costs. This initiative supports Governor Lujan Grisham’s
energyenergy-efficiencybuilding-upgradeslow-interest-loansHVAC-systemssmart-thermostatsenergy-auditsTrump’s 2025 R&D Retreat Ignores Key Lessons from "The Entrepreneurial State" - CleanTechnica
The article critiques the Trump administration’s 2025 plan to reduce government R&D investment, contrasting it with insights from Mariana Mazzucato’s 2024 book, which highlights the essential role of state-led innovation in driving transformative technologies. Mazzucato challenges the common belief that breakthrough innovation is primarily driven by private firms, emphasizing that governments have historically borne the significant risks of early-stage, radical research. She provides examples such as the internet, biotechnology, and pharmaceuticals, where foundational technologies were developed and funded by public agencies long before private companies commercialized them. Venture capital, often celebrated as a key innovation driver, typically enters later in the cycle, focusing on scaling rather than pioneering uncertain technologies. The article further illustrates how critical energy technologies like solar panels, wind turbines, and lithium-ion batteries emerged from decades of patient government R&D, underpinning companies like Tesla. Even the shale gas boom, commonly viewed as a free-market success, relied heavily on federal funding for early hydraulic fracturing research.
energygovernment-fundinginnovationR&Dclean-technologysolar-energylithium-ion-batteriesWhich Auto Brands Will Lead EV Sales Worldwide in Next 3 Years? You Tell Us! (Charts) - CleanTechnica
A recent CleanTechnica survey asked readers to predict which auto brands will lead global electric vehicle (EV) sales from 2025 to 2027. The overwhelming consensus was that BYD will be the top-selling EV brand each year, with over 86% of respondents consistently selecting BYD as the #1 producer. This aligns with BYD’s recent rise, having surpassed Tesla in sales, while Tesla’s sales have reportedly declined. Other brands receiving notable mentions for the top spots included Tesla, Geely, Volkswagen, Hyundai, and a few Chinese manufacturers like XPENG and Xiaomi, though none came close to challenging BYD’s dominance in the predictions. For the #2 and #3 positions, the survey showed more variation and competition. In 2025, Tesla was the leading choice for #2 with 43.3% of votes, followed by Geely and Volkswagen. By 2026, Geely was predicted to rise to #2 with 37.6%, while Tesla
energyelectric-vehiclesEV-salesautomotive-industryclean-energybattery-technologysustainable-transportationRussian firm advances Gen-V nuclear fuel loading for closed fuel cycle
Russian state nuclear corporation Rosatom has initiated the pilot operation of fifth-generation (Gen-V) nuclear fuel assemblies, designated TVS-5, by loading them into the VVER-1200 reactor core at the Novovoronezh Nuclear Power Plant (NPP). Manufactured by the Novosibirsk Chemical Concentrates Plant, these fuel bundles are designed for fully automated fabrication, enabling industrial-scale production critical for advancing a closed nuclear fuel cycle. The pilot phase will span three 18-month fuel cycles, using a regular enriched uranium dioxide fuel matrix under strict regulatory oversight by Rostechnadzor. This development marks a significant milestone in Russia’s strategic shift toward a dual-component nuclear power system that integrates thermal and fast neutron reactors with a closed fuel cycle. The closed cycle aims to reuse spent nuclear fuel by reprocessing uranium and plutonium, thereby improving resource efficiency and sustainability in nuclear power generation. Rosatom emphasizes that the TVS-5 fuel design and its automated manufacturing process are essential steps toward enabling the
energynuclear-fuelnuclear-powerautomated-fabricationclosed-fuel-cycleVVER-1200RosatomChina to test satellite refueling in space as US spies watch closely
China is set to conduct a pioneering orbital refueling test involving two satellites, Shijian-21 and Shijian-25, in geostationary orbit (GEO). The test, scheduled for June 11, will see Shijian-25 transfer approximately 313 pounds (142 kg) of hydrazine fuel to Shijian-21, potentially extending the latter’s operational life by eight years. Developed by the Shanghai Academy of Spaceflight Technology, these satellites have already demonstrated complex orbital maneuvers, including Shijian-21’s 2022 docking with a defunct Beidou navigation satellite to move it to a graveyard orbit. This test marks China’s first on-orbit refueling attempt in GEO and represents a significant technological advancement. The United States is closely monitoring the operation through two surveillance satellites, USA 270 and USA 271, part of the Geosynchronous Space Situational Awareness Program. These US satellites have maneuvered to observe the Chinese satellites
energysatellite-technologyspace-refuelingorbital-dockingaerospace-materialsspace-technologysatellite-lifespan-extensionRolls-Royce to power 3 million UK homes with 1.5 GW nuclear reactors
Rolls-Royce has been selected by the UK government and the state-owned Great British Energy – Nuclear as the preferred bidder to develop the country’s first fleet of Small Modular Reactors (SMRs). The project aims to generate 1.5 gigawatts (GW) of electricity, enough to power approximately 3 million homes. Unlike traditional nuclear plants built entirely on-site, these SMRs will be factory-manufactured in modules and then assembled at the final location, a method intended to reduce construction costs, complexity, and delays. Each Rolls-Royce SMR will produce 470 megawatts, with the technology expected to begin generating power by 2032 at the earliest. This initiative is part of a broader UK nuclear strategy that includes a £14.2 billion investment in the large Sizewell C power station and a £2.5 billion commitment to the SMR program during the current Spending Review period. The government highlights that SMRs are smaller, quicker to build,
energynuclear-powersmall-modular-reactorsRolls-Royceclean-energyUK-energy-strategypower-generationSmall nuclear reactor to unleash 1,832°F heat in US for future power
NuCube Energy, a California-based company, is collaborating with the Utah San Rafael Energy Research Center (USREL) to test its next-generation small nuclear microreactor technology. This innovative reactor can deliver heat exceeding 1,832°F (1,000°C), enabling high-temperature industrial applications and off-grid power generation. The technology is notable for producing cost-competitive electricity that can rival natural gas, and it can operate independently from existing power grids, which is particularly beneficial for rural and industrial areas. The reactor design incorporates TRISO fuel and heat pipe technology to minimize moving parts, enhancing safety and reliability. Housed within a stainless-steel compartment, the microreactors also streamline permitting processes. The collaboration with USREL, known for demonstrating advanced power generation technologies, aims to advance NuCube’s modular reactors toward commercialization. This partnership is expected to support clean, affordable, and reliable energy solutions while facilitating integration with chemical and energy conversion processes, potentially transforming energy access in states like Utah.
energynuclear-reactormicroreactorclean-energyhigh-temperature-heatmodular-reactorsenergy-researchUptime Industries wants to boost localized AI usage with an ‘AI-in-a-box’ called Lemony AI
Uptime Industries has developed Lemony AI, a compact “AI-in-a-box” device designed to run large language models (LLMs), AI agents, and workflows locally on-premise. About the size of a sandwich and consuming only 65 watts of power, each Lemony node can support LLMs with up to 75 billion parameters, hosting both open-source and adapted closed models. Multiple devices can be stacked to form clusters, allowing different models to run simultaneously. The company has partnered with IBM and JetBrains to facilitate customer access to various AI models, including IBM’s proprietary ones. The concept originated from a side project by Uptime’s co-founders, who explored distributing language models on small devices like Raspberry Pis. Recognizing the potential for localized AI to enhance adoption—especially among enterprises wary of cloud-based solutions—they focused on creating a small, privacy-centric device that teams could deploy without extensive organizational approval. This approach appeals particularly to regulated sectors such as finance, healthcare, and law, where data privacy is critical since all data and models remain within the device. Uptime has raised $2 million in seed funding to advance development, plans to extend its Lemony OS software to other hardware platforms, and aims to evolve from single-user to team-based software functionality. Lemony AI is offered at $499 per month for up to five users.
energyAI-hardwareedge-computingon-premise-AIlow-power-devicesAI-clustersdata-privacySparkCharge And Its Charging As A Service Platform — A CleanTechnica Exclusive - CleanTechnica
The article highlights SparkCharge's innovative approach to electric vehicle (EV) charging through its Charging as a Service (CaaS) platform, which offers fully mobile, off-grid charging solutions. Unlike traditional fixed charging stations, SparkCharge provides turnkey, scalable services including Mobile Battery Chargers, Off-Grid Power Hubs, and Permanent Infrastructure that deliver charging directly to EVs wherever needed, without reliance on utility grids or public infrastructure. This model addresses key challenges in EV adoption by enabling faster deployment, greater flexibility, and improved uptime, particularly benefiting fleet operators and businesses in areas lacking reliable charging infrastructure. Based in Somerville, Massachusetts, SparkCharge leverages its urban environment to develop practical, scalable solutions tailored to real-world needs. The company has played a significant role in closing the EV infrastructure gap in the Greater Boston area, a region that ranks relatively low in EV adoption compared to other major U.S. metros. By bypassing the lengthy and costly process of installing permanent stations, SparkCharge’s mobile charging network accelerates access to EV charging in dense urban settings, fleet depots, and other challenging locations. The presence of SparkCharge’s mobile vans also fosters public engagement and awareness, showcasing the flexibility and accessibility of their charging solutions. The article also references a case study of a Los Angeles-based client using SparkCharge’s mobile services to support a large fleet of EV delivery vans, illustrating the practical benefits of charging anywhere and anytime. Overall, SparkCharge is positioned as a transformative player in the EV charging industry, focusing on service-driven, adaptable infrastructure that meets the evolving needs of businesses and urban communities.
energyelectric-vehiclesEV-chargingmobile-chargingoff-grid-powerCharging-as-a-Servicefleet-electrificationSodium Batteries Are Coming For Your Gasmobiles
The article discusses the emerging role of sodium-ion batteries as a promising alternative to lithium-ion batteries, particularly in stationary energy storage and potentially in electric vehicles (EVs). California startup Unigrid is advancing toward large-scale production of next-generation sodium batteries, initially targeting residential energy storage with plans to expand into commercial, industrial, utility-scale, and EV markets, including two-wheelers, three-wheelers, passenger cars, and off-road vehicles. The California Energy Commission (CEC) has awarded Unigrid nearly $3 million to develop a pilot production line in San Diego capable of producing 250 to 750 cylindrical sodium batteries per day. These batteries aim to offer higher volumetric energy density than current commercial options due to proprietary electrolyte and anode chemistry. Sodium batteries are attractive because they use abundant and inexpensive materials like salt, addressing supply chain and ethical concerns tied to lithium, cobalt, and other materials used in lithium-ion batteries. While sodium batteries currently have comparable costs to lithium-ion batteries, they offer advantages in safety—being less prone to failure or fire under extreme conditions—and environmental impact, as they avoid the hazardous and volatile substances found in lithium-ion battery fabrication. Although sodium batteries have historically faced challenges limiting their use in mobility applications, Unigrid claims its new anode formula improves performance, and other innovators are also making progress. The article indicates that sodium batteries could soon become viable for EVs, but details on cost reductions and performance improvements remain partially undisclosed.
energybatteriessodium-ion-batteriesenergy-storageelectric-vehiclesbattery-technologyrenewable-energyInside The Slate Auto Factory - CleanTechnica
Slate Auto, partially backed by Jeff Bezos, is positioning itself as an "anti-Tesla" in the electric vehicle market by focusing on simplicity and utility rather than high-tech features. Unlike Tesla’s feature-rich electric cars, Slate builds bare-bones electric trucks designed to be tough, practical, and affordable. The base model comes with unpainted, dent- and rust-proof gray polypropylene panels and weighs about 3,600 pounds with a standard 52.7 kWh battery, significantly lighter and smaller than Tesla’s Cybertruck. Customers can customize their trucks with optional upgrades, including kits to convert the vehicle into a five-seat fastback or a squared-off style reminiscent of classic rugged trucks like the Ford Courier or Jeep Wrangler. The starting price is estimated around $25,000, emphasizing affordability and straightforward utility. Slate’s manufacturing approach centers on simplifying production to reduce costs and accelerate market entry. The company is currently hand-building prototypes and pre-production vehicles at a small assembly line in Orion Township, Michigan, while its main production facility is being established in a former printing plant in Warsaw, Indiana, with a planned capacity of up to 150,000 vehicles per year. Slate’s leadership emphasizes flexibility in their production plans and aims to deliver a new category of electric trucks that meet essential needs without unnecessary complexity. This strategy is intended to disrupt the market by providing honest, no-frills electric trucks at a lower price point, contrasting sharply with the more luxurious and heavier electric trucks currently dominating the market.
energyelectric-vehiclesbattery-technologyautomotive-manufacturinglightweight-materialselectric-trucksclean-energyPoll: Large majority of Canadians favour more open car market with better access to affordable Chinese and European EVs - Clean Energy Canada
A recent survey by Abacus Data for Clean Energy Canada reveals strong Canadian support for a more open vehicle market with greater access to affordable electric vehicles (EVs), particularly from Chinese and European manufacturers. While 53% of Canadians favor lowering the current 100% tariff on Chinese EVs to balance industry protection and affordability, 29% support removing the tariff entirely to reduce costs and avoid trade retaliation. Only 19% want to maintain the full tariff. This consensus spans political affiliations, indicating broad cross-partisan agreement. Additionally, 70% of respondents back allowing the sale of any vehicle meeting European safety and environmental standards, which would increase the availability of smaller, more affordable EV models in Canada. The survey also highlights that 58% of Canadians want to uphold Canada’s current tailpipe emission standards, aligning with stricter U.S. regulations under President Biden and California’s policies, while only 18% support weakening these standards. Interest in purchasing EVs as the next vehicle has decreased by 13 points since 2022, with 45% expressing certainty or likelihood to buy one. However, enthusiasm remains higher among younger Canadians, residents of Quebec and British Columbia, and urban populations in regions like Metro Vancouver (69% favor EVs) and the Greater Toronto Hamilton Area (55-62% favor EVs depending on information provided). Clean Energy Canada emphasizes that the main barrier to EV adoption is high sticker prices, and Canadians want access to high-quality, lower-cost electric cars from global markets.
energyelectric-vehiclesclean-energytariffsemission-standardsvehicle-marketCanadaStandard Nuclear emerges from the ashes of a failed startup
Standard Nuclear has launched with $42 million in funding to develop advanced nuclear fuel, building upon assets acquired from the bankruptcy of Ultra Safe Nuclear Corporation (USNC) for $28 million. The new company’s CEO, Kurt Terrani, was formerly USNC’s vice president. The funding round was led by Decisive Point, with participation from Andreessen Horowitz and others. Standard Nuclear has secured $100 million in non-binding fuel sales projected for 2027 and is collaborating with customers such as Nano Nuclear Energy and Radiant Industries. The company acknowledges that acquiring USNC’s assets accelerated its timeline. USNC had focused on commercializing TRISO fuel—uranium pellets coated with carbon- and ceramic-based layers—which is considered safer and more meltdown-resistant than traditional nuclear fuel, though it has not been widely used since its development in the 1950s. USNC’s history was marked by a broad and ambitious business model, including two reactor designs, nuclear propulsion, and spacecraft heating systems, but it was primarily funded by a single investor, Richard Hollis Helms, who invested over $100 million plus loans. Helms, a former CIA Arabist, founded USNC after retiring from intelligence work. Despite efforts to raise more capital in 2022, USNC struggled financially and declared bankruptcy in October 2024 amid mounting debts and payroll issues. Standard Nuclear, led by Decisive Point founder Thomas Hendrix, purchased USNC’s fuel-related assets in a bankruptcy auction completed in February 2025, establishing its operational base and continuing the development of TRISO fuel technology.
energynuclear-energyadvanced-nuclear-fuelTRISO-fuelstartup-fundingnuclear-materialsnuclear-reactorsUS Air Force reveals new nuclear cruise missile for B-21, B-52 planes
The US Air Force has unveiled the AGM-181A Long-Range Standoff (LRSO) missile, a new nuclear-armed cruise missile developed by Raytheon to replace the aging AGM-86B Air-Launched Cruise Missile. Designed to arm the B-21 Raider stealth bomber and upgraded B-52 Stratofortress, the LRSO features advanced stealth capabilities, resilience against electronic warfare, and precise navigation to operate effectively in contested environments. Armed with the W80-4 thermonuclear warhead, the missile is optimized for low observability, autonomous threat avoidance, and adaptive targeting, enabling it to penetrate advanced air defenses and strike high-value targets from standoff distances. The LRSO is part of a broader integrated strike architecture involving space-based sensors, command-and-control systems, and potentially classified escort aircraft, aimed at enhancing US nuclear deterrence amid growing strategic challenges from Russia and China. Its standoff range offers flexible deterrent options, including forward deployment and mission recall, which are critical for escalation control during crises. Flight testing is underway under secrecy, with operational deployment expected in the latter half of the decade. The program is projected to cost $16 billion for over 1,000 missiles plus $7 billion for lifecycle support, with a unit cost of about $14 million. Plans for a conventional variant have been dropped, leaving the AGM-158 JASSM family to fulfill non-nuclear strike roles. The LRSO addresses a crucial gap in US nuclear capabilities and underscores continued American resolve in great power competition.
energymilitary-technologymissile-technologynuclear-weaponsstealth-technologyaerospace-engineeringdefense-systemsProxima Fusion joins the club of well-funded nuclear contenders with €130M Series A
Proxima Fusion, a German nuclear fusion startup, has raised €130 million (about $148 million) in a Series A funding round led by Balderton Capital and Cherry Ventures. This brings its total funding to over €185 million ($200 million), positioning Proxima as a leading European contender in the race to develop commercial fusion energy. The company focuses on stellarator reactors, which use twisted magnetic fields to confine plasma more stably than the more common tokamak designs. Proxima’s Stellaris design, developed near Germany’s Wendelstein 7-X stellarator, represents a significant technical milestone that helped secure the oversubscribed funding round. CEO Francesco Sciortino emphasized that the new capital will enable Proxima to reach critical milestones, including a key hardware demonstration planned for 2027, with the goal of advancing toward commercial viability by around 2031. The funding round attracted primarily European investors, reflecting a broader ambition for Europe to play a leadership role in the global energy transition by developing clean, stable, and uranium-free fusion power. Proxima operates across multiple European countries, with headquarters in Munich and research teams in Switzerland and the UK, underscoring its pan-European identity and commitment to building a sustainable energy future on the continent.
energynuclear-fusionclean-energyfusion-startupsventure-capitalenergy-securityfusion-reactorsThe US Produced More Energy than Ever Before in 2024 - CleanTechnica
In 2024, the United States achieved a record high in total energy production, surpassing 103 quadrillion British thermal units (Btu), marking a 1% increase over the previous record set in 2023. Key contributors to this growth included natural gas, crude oil, natural gas plant liquids (NGPL), biofuels, solar, and wind energy, each setting new domestic production records. Natural gas remained the largest source of U.S. energy since 2011, accounting for nearly 38 trillion cubic feet in 2024, consistent with 2023 levels. Crude oil production also hit a record, increasing by 2%, primarily driven by output from the Permian Basin in New Mexico and Texas. Conversely, coal production declined to its lowest annual output since 1964, reflecting a long-term decrease since coal was the dominant energy source from 1984 through 2010. NGPLs, which include fuels like ethane and propane associated with natural gas, accounted for about 9% of total U.S. energy production and rose 7% from 2023, continuing a growth trend since 2005. Renewable energy sources such as biofuels, wind, and solar also set production records, contributing to the overall energy increase. Notably, biofuel production, including sustainable aviation fuels (SAF), reached 1.4 million barrels per day, a 6% rise from the previous year. The article highlights that while some traditional energy sources used primarily for electricity generation have peaked decades ago, the U.S. continues to diversify its energy mix with increasing contributions from renewables and cleaner fuels. The data referenced in the article comes from the U.S. Energy Information Administration and uses standardized energy units (Btu) to compare different energy types. The report underscores the ongoing transition in U.S. energy production, with fossil fuels like natural gas and oil still dominant but renewable and alternative energy sources growing rapidly. The article also encourages readers to engage with CleanTechnica’s content for further analysis and updates on energy trends.
energyrenewable-energyUS-energy-productionnatural-gascrude-oilbiofuelssolar-powerArtificial Intelligence Models Improve Efficiency of Battery Diagnostics - CleanTechnica
The National Renewable Energy Laboratory (NREL) has developed an innovative physics-informed neural network (PINN) model that significantly enhances the efficiency and accuracy of diagnosing lithium-ion battery health. Traditional battery diagnostic models, such as the Single-Particle Model (SPM) and the Pseudo-2D Model (P2D), provide detailed insights into battery degradation mechanisms but are computationally intensive and slow, limiting their practical use for real-time diagnostics. NREL’s PINN surrogate model integrates artificial intelligence with physics-based modeling to analyze complex battery data, enabling battery health predictions nearly 1,000 times faster than conventional methods. This breakthrough allows researchers and manufacturers to non-destructively monitor internal battery states, such as electrode and lithium-ion inventory changes, under various operating conditions. By training the PINN surrogate on data generated from established physics models, NREL has created a scalable tool that can quickly estimate battery aging and lifetime performance across different scenarios. This advancement promises to improve battery management, optimize design, and extend the operational lifespan of energy storage systems, which are critical for resilient and sustainable energy infrastructures.
energybattery-diagnosticsartificial-intelligenceneural-networkslithium-ion-batteriesbattery-healthenergy-storageREPORT: U.S. Adds 8.6 GW of New Solar Module Manufacturing Capacity, One of its Strongest Quarters of Growth in U.S. History - CleanTechnica
The U.S. solar industry experienced a significant manufacturing surge in Q1 2025, adding 8.6 gigawatts (GW) of new solar module capacity—the third-largest quarterly increase on record—driven by eight new or expanded factories in Texas, Ohio, and Arizona. Solar cell production capacity also doubled to 2 GW with a new factory in South Carolina. Overall, 10.8 GW of new solar electricity generating capacity was installed in the quarter, with solar and storage accounting for 82% of all new U.S. generating capacity, underscoring solar’s dominant role in the nation’s energy mix and manufacturing growth. However, this growth faces serious threats from recently passed House federal tax legislation, new tariffs, and potential changes to federal energy incentives. These policy shifts could undermine the solar industry's expansion by making energy tax credits unusable, imposing anti-dumping and countervailing duties on imports from Southeast Asia, and creating business uncertainty. Analysts warn that these developments risk causing energy shortages, job losses (up to 330,000), factory closures (331 projected), and a $286 billion loss in local investments. Additionally, electricity costs for consumers could rise by $51 billion nationwide, jeopardizing America’s energy independence and manufacturing boom unless Congress acts to amend the legislation.
energysolar-energysolar-manufacturingrenewable-energyU.S.-energy-policysolar-modulesenergy-capacityWhat Happens When AI, EVs, and Smart Homes All Plug In at Once? - CleanTechnica
The article from CleanTechnica discusses the growing challenges faced by the electric distribution grid as artificial intelligence (AI), electric vehicles (EVs), and smart homes increasingly demand more energy. It highlights that much of our energy consumption is invisible, powering everything from data centers and AI systems to e-mobility and smart home technologies. According to a 2025 study by the National Electrical Manufacturers Association (NEMA), US electricity demand is expected to rise by 50% by 2050, driven largely by a 300% increase in data center energy use and a staggering 9,000% rise in energy consumption for electric mobility and charging. The International Energy Agency warns that the rapid expansion of data centers could strain local power networks, risking more frequent blackouts if grid upgrades do not keep pace. The article emphasizes that the current grid infrastructure is ill-equipped to handle this surge in demand without significant investment and modernization. Utilities like CenterPoint Energy are proactively investing billions in grid improvements to meet future needs, anticipating substantial increases in peak electricity usage. Technological innovations, such as smart grid automation and advanced protection devices, offer promising solutions to enhance grid resilience and reliability. These technologies help manage energy fluctuations, improve efficiency, and reduce service interruptions, positioning the grid to better support the evolving energy landscape shaped by AI, EVs, and smart homes.
energyelectric-gridelectrificationdata-centersartificial-intelligenceenergy-consumptionsmart-homesElon Musk's Political Naivete, Part 376 - CleanTechnica
The article critiques Elon Musk’s political naivete, particularly regarding his expectations that Republicans would cut subsidies for oil and gas alongside electric vehicle (EV) subsidies to create a level playing field. Musk reportedly believed that the Republican Party might reduce or eliminate fossil fuel subsidies to address the deficit, an idea the author finds implausible given the party’s historical support for oil and gas interests. Musk also argued on the campaign trail that removing EV subsidies would hurt Tesla’s competitors more than Tesla itself, a notion described as unrealistic given the growing competition in the EV market. Additionally, the article highlights a congressional proposal to eliminate fuel economy fines for automakers, which could undermine EV adoption by removing penalties for not meeting fleet fuel economy standards. The author emphasizes that fuel economy requirements currently incentivize automakers to produce and sell EVs, reflecting genuine consumer demand. Musk’s earlier efforts to promote a carbon tax with Donald Trump are also discussed, with the article labeling this as politically naive due to the strong opposition to such measures in the US, especially among Republicans who often deny climate change. Overall, the piece portrays Musk as idealistic but politically uninformed, particularly regarding US climate and energy policy realities.
energyelectric-vehiclessubsidiesfuel-economycarbon-taxTeslaclean-energy-policies"The Loss of Anybody at NOAA is Directly Connected to Services Lost By Every Individual in the United States" - CleanTechnica
The article from CleanTechnica highlights the severe consequences of proposed budget cuts to the National Oceanic and Atmospheric Administration (NOAA), particularly targeting its Office of Oceanic and Atmospheric Research (OAR). The suggested reduction of $485 million would slash OAR’s funding to just over $171 million, effectively eliminating it as a line office. This would dismantle critical research efforts on climate change and atmospheric phenomena, reversing decades of scientific progress and severely undermining the United States’ ability to predict and prepare for extreme weather events such as hurricanes. The article underscores that despite having reliable NOAA data, recent storms like Hurricanes Helene and Milton caused significant destruction and loss, emphasizing the vital role NOAA plays in disaster preparedness. Key institutions such as the University of Miami’s Cooperative Institute for Marine and Atmospheric Sciences (CIMAS) and the Atlantic Oceanographic and Meteorological Laboratory (AOML) face closure under the proposed cuts. These centers are essential for hurricane hunter missions that provide critical data for forecasting hurricane paths and intensities, contributing to nearly $5 billion in savings per major hurricane. The article stresses that shutting down these institutions would not only reduce forecasting accuracy but also lead to substantial financial and human costs. Additionally, NOAA’s Regional Climate Centers, which support farmers with climate data for managing frost, drought, and other weather-related risks, would cease operations, further impacting agricultural decision-making and resilience. In summary, the article argues that defunding NOAA’s research capabilities is both economically and socially detrimental, threatening public safety, agricultural productivity, and the nation’s ability to respond to climate change. It calls the proposed budget cuts absurd and inhumane, noting that maintaining and enhancing NOAA’s services is crucial for protecting lives, property, and the environment across the United States.
energyclimate-changeNOAAhurricane-predictionatmospheric-researchenvironmental-sciencedisaster-preparednessSolid lithium-air battery delivers 4x energy, 1,000 lifecycles
Researchers at the Illinois Institute of Technology and Argonne National Laboratory have developed a solid-state lithium-air battery that achieves four times the energy density of traditional lithium-ion batteries, potentially rivaling gasoline in energy storage capacity. This breakthrough is enabled by a novel four-electron chemical reaction at room temperature, allowing the formation and reversible decomposition of lithium oxide (Li₂O), which stores significantly more energy than the lithium superoxide or lithium peroxide reactions used in previous lithium-air batteries. The battery employs a solid ceramic-polymer electrolyte embedded with lithium-rich nanoparticles, replacing flammable liquid electrolytes to enhance safety and electrochemical stability. A key component of this innovation is the trimolybdenum phosphide (Mo₃P) catalyst, which facilitates the stable four-electron transfer reaction over extended use. The battery demonstrated durability of at least 1,000 charge-discharge cycles at room temperature without significant degradation. Cryogenic transmission electron microscopy confirmed the reversible lithium oxide reaction, validating the approach. With an estimated energy density of 1,200 watt-hours per kilogram, this technology promises to dramatically extend electric vehicle range, reduce battery size and weight, and improve the safety and efficiency of renewable energy storage. Supported by major funding agencies, this advancement could pave the way for a new generation of high-capacity, safe, and sustainable batteries.
energylithium-air-batterysolid-state-electrolytebattery-technologyenergy-storageelectric-vehiclesmaterials-science3 Ridiculous Things About Donald Trump Forcing A Coal Power Plant To Stay Open - CleanTechnica
The article by Steve Hanley criticizes the Trump administration, specifically the Department of Energy led by a fossil fuel billionaire, for forcing a Michigan utility company to keep an outdated and polluting coal power plant operational despite having a newer natural gas plant built to replace it. This mandate is described as absurd and counterproductive, especially given the administration’s contradictory stance on climate change: denying global warming publicly while invoking emergency powers due to expected extreme heat to justify keeping the coal plant running. Hanley highlights this as a hypocritical and environmentally harmful approach that exacerbates global heating rather than addressing it responsibly. Additionally, the article points out the irony of a Republican-led government, which typically advocates for limited government intervention, imposing a heavy-handed federal order that disrupts market efficiency and forces Consumers Energy to maintain an uneconomical power source. This intervention leads to higher electricity costs for ratepayers across Michigan and 14 other states, with no prior consultation from state regulators or grid operators. The author condemns this as unnecessary government overreach that increases financial burdens on consumers while undermining clean energy progress, labeling the policy as “brilliant idiocy” for its counterproductive and costly consequences.
energycoal-power-plantfossil-fuelselectricity-gridenergy-policyclimate-changeutility-costsWhat Can We Do To Save The Insects? Build Solar Arrays - CleanTechnica
The article highlights the alarming decline of insect populations, driven initially by habitat loss and pesticide use, and now increasingly exacerbated by climate change. Even protected forest areas are experiencing insect losses as warming and drying conditions disrupt ecosystems. This decline has cascading effects, notably on insect-eating birds, which have seen dramatic population drops in the US since the 1970s. The article emphasizes that climate change is a central threat to insects, altering natural rhythms and ecosystem interactions. A key positive insight presented is that solar arrays, often criticized for environmental impact, can actually serve as beneficial habitats for insects and other wildlife. The wide sunny spaces between solar panels support diverse species, attracting birds and mammals, and providing better habitats than surrounding agricultural monocultures, which are heavily treated with pesticides. Solar farms also have minimal human disturbance, further protecting these ecosystems. Additionally, solar energy offers a scalable, clean alternative to fossil fuels, helping mitigate climate change—the root cause of insect declines. To further support insect recovery, the article advocates for habitat restoration, reducing pesticide use, and creating insect-friendly environments such as wildflower meadows and native plant gardens. Examples include efforts like Britain’s King Charles III’s restoration of cultivated lands to natural habitats. The piece calls for cultural and land-use shifts to sustain pollinators, emphasizing that protecting insects requires both large-scale solutions like solar agrivoltaics and everyday actions such as sustainable gardening and pesticide reduction.
energysolar-energyrenewable-energyinsect-habitatclimate-changeagrivoltaicsbiodiversityA Political Battle Is Brewing Over Data Centers
The article discusses the emerging political conflict surrounding a 10-year moratorium on state-level AI regulation included in former President Donald Trump’s "Big Beautiful Bill." This moratorium has raised concerns about its potential impact on the siting and regulation of AI data centers. Representative Thomas Massie criticized the provision for potentially enabling corporations to build massive AI data centers near residential areas by limiting local governments' ability to regulate zoning and land use. The National Conference of State Legislatures (NCSL) also opposed the moratorium, emphasizing that local laws help communities manage data center impacts such as utility costs, water resource use, and grid stability. The debate highlights broader tensions between federal and state authority over AI regulation. Some lawmakers, including Representative Marjorie Taylor Greene, expressed fears that the moratorium undermines federalism and could lead to forced eminent domain for data center development. Critics argue the moratorium is an overly broad restriction on state AI laws, while supporters, including White House AI adviser David Sacks, contend that a unified federal standard is necessary to avoid a confusing patchwork of state regulations that could hinder innovation. A senior official involved in the bill’s negotiation clarified that the moratorium was not intended to restrict local control over physical infrastructure like data centers, but rather to create a clear federal framework for AI model regulation. The controversy over the moratorium reflects growing local resistance to the rapid expansion of data centers across the U.S., which consume significant electricity and water resources. Data centers’ rising energy demands—expected to triple by 2035—have led to community pushback despite their economic benefits. The article underscores how the intersection of AI regulation and data center development is becoming a contentious issue, with local, state, and federal interests increasingly at odds.
energydata-centersAI-regulationstate-legislationutility-costsgrid-stabilitywater-resourcesWorld’s first robot city to rise beneath Japan’s Mount Fuji in 2025
Toyota is set to launch the world’s first fully connected, self-contained “robot city” called Woven City at the base of Mount Fuji, Japan, in fall 2025. Situated on the 175-acre former Higashi-Fuji plant site in Shizuoka Prefecture, about 140 kilometers southwest of Tokyo, this experimental metropolis will serve as a real-world testbed for future mobility, smart infrastructure, and sustainable living. Initially housing 100 residents—mainly Toyota engineers and their families—the population is expected to grow to 360 in the first phase, with a long-term goal of 2,000 inhabitants. The city’s residents are divided into “Inventors,” who develop new technologies, and “Weavers,” who provide user feedback. Central to the city’s design is Toyota’s autonomous electric vehicle platform, the e-Palette, which will operate alongside an underground logistics network and dedicated surface lanes for pedestrians, slower mobility devices, and autonomous vehicles. Beyond mobility, Woven City emphasizes sustainability and resilience through a hydrogen fuel cell energy grid supplemented by solar panels, water recycling, and advanced waste management. Smart homes equipped with robotics and AI will monitor health, manage energy, and optimize daily life, while the entire urban system is interconnected via sensors and AI to create a living digital operating system. The city functions both as a simulation environment and a functioning habitat, enabling direct testing of smart infrastructure technologies. Although not open to tourists initially, Toyota plans to allow public access starting in 2026. Ultimately, Woven City aims to serve as a scalable model for future urban planning worldwide, demonstrating how public-private partnerships can foster next-generation technologies amid growing climate and security challenges.
robotIoTenergyautonomous-vehiclessmart-cityhydrogen-fuel-cellssustainable-livingGM Sees Strong EV Sales Growth In 2025 - CleanTechnica
General Motors (GM) reported strong growth in electric vehicle (EV) sales in the U.S. during the first five months of 2025, positioning itself as the second-largest EV seller nationwide with over 62,000 units sold across its Chevrolet, Cadillac, and GMC brands. Chevrolet alone sold more than 37,000 EVs through May, surpassing Ford and becoming the fastest-growing domestic EV brand in the first quarter. May marked GM’s second-best month ever for EV sales, following a 94% year-over-year increase in Q1. GM’s U.S. EV market share doubled to about 15.5% in early Q2, nearing its overall national market share of 17%. GM attributes this success to its broad EV portfolio, including the popular and affordable Chevrolet Equinox EV, which accounted for over 21,800 sales so far this year. More than half of Chevrolet’s EV sales were conquest sales, meaning customers new to the brand. GM also highlighted its expanding charging infrastructure, with access to over 250,000 public chargers across North America and partnerships to increase fast-charging locations nationwide. Notably, GM’s EVs now come standard with NACS charging ports compatible with Tesla Superchargers, although the company did not emphasize this in its communications. The company emphasizes that many EV owners remain loyal once they switch, especially after investing in home charging setups, which can often be as simple as a standard 120-volt outlet for typical daily driving needs.
energyelectric-vehiclesEV-salescharging-infrastructureGMclean-energysustainable-transportationHigh Energy Bills? Blame A Republican! - CleanTechnica
The article from CleanTechnica highlights the impending rise in energy bills this summer, largely due to increasing natural gas prices and higher temperatures driving up air conditioning use. It emphasizes the role of the US solar industry as a sustainable solution to these challenges, but criticizes Republican lawmakers for advancing policies that threaten this progress. Specifically, the article points to a recently passed House budget bill—dubbed the “Big Beautiful Bill” by Trump and House Republicans—that includes provisions undermining domestic solar manufacturing and installation, particularly harming states that supported Trump in the 2024 election. The piece details how the Biden administration had invested federal grants and loans into solar manufacturing facilities in Trump-voting states, aiming to create jobs and economic growth. However, the new budget bill threatens to eliminate these programs, which the Solar Market Insight report warns will disproportionately impact solar jobs and factories in these regions. With Republicans controlling both the House and Senate, the article argues that they hold the power—and responsibility—to reverse these damaging changes but are unlikely to do so. Instead, the article suggests that Republicans favor building more gas power plants, a less sustainable approach that could further exacerbate high energy costs. Overall, the article assigns significant blame to Republican congressional actions for the rising energy bills and job losses in the renewable energy sector, while acknowledging other factors also contribute to energy cost increases. It underscores the political dynamics at play, where Republican control of Congress and the administration’s policies are at odds, with the future of clean energy incentives and programs hanging in the balance.
energysolar-energyrenewable-energyenergy-policyenergy-billssolar-manufacturingUS-energy-industryMitsubishi's battery swap network to cut EV charging time to 5 mins
Mitsubishi Fuso Truck and Bus Corporation (MFTBC), Mitsubishi Motors, U.S. startup Ample, and Yamato Transport have launched a major battery swapping initiative in Tokyo to accelerate electric vehicle (EV) adoption and support Japan’s climate goals of reducing emissions by 46% by 2030 and achieving carbon neutrality by 2050. The project, backed by the Tokyo Metropolitan Government, will deploy over 150 battery-swappable commercial EVs and 14 automated modular swapping stations by September 2025. This follows a successful 2024 pilot in Kyoto that demonstrated cross-brand battery swapping feasibility for commercial deliveries and taxi services. The initiative focuses on commercial fleet electrification, a strategic priority since transportation accounted for about 19% of Japan’s CO2 emissions in 2022. The vehicles involved include MFTBC’s eCanter light-duty electric truck and Mitsubishi Motors’ kei-class Minicab EV, with Yamato Transport as the first major customer for last-mile delivery operations. The key technological advantage lies in Ample’s fully automated swapping stations, which can replace batteries in just five minutes without drivers leaving their vehicles, minimizing downtime and labor challenges. These compact stations are designed for quick deployment in urban environments and may also provide grid services such as renewable energy storage, further contributing to emission reductions. The consortium aims to build a robust battery swapping infrastructure in Tokyo and invites additional automakers, fleets, and logistics companies to participate, expanding the initiative’s impact on Japan’s sustainable transportation future.
energyelectric-vehiclesbattery-swappingMitsubishi-Motorscarbon-neutralitysustainable-transportationEV-charging-infrastructure60-feet long solar-electric catamaran with 800-mile-range sets sail
Revolution Marine Group, a Florida-based company, has unveiled its latest 60-foot solar-electric catamaran, the Oceanwalker S60e, targeting the growing market for eco-friendly yachts. This model features a sleek dual-hull design powered by twin 150 kW (200 hp) electric motors and supported by a 10 kW solar array that powers onboard amenities such as air-conditioning and electric cooking. While the exact electric-only range is undisclosed, the yacht includes two 45 kW diesel generators that extend its total range up to 800 nautical miles, providing flexibility for longer voyages. The yacht also offers customizable interior layouts with three or four cabins, catering to private owners and luxury charters. Construction of the first Oceanwalker S60e is underway at the Fujian Sky Walker shipyard in China, with delivery expected by April 2026. The vessel’s first home will be Club Ki’ama Bahamas, an exclusive solar-powered yacht and residence club on Elizabeth Island. Club Ki’ama’s management praised the yacht as a perfect complement to their sustainable oceanfront community. Revolution Marine’s CEO Edward Sacks emphasized the company’s commitment to innovation and quality, hinting at future larger models in the Oceanwalker lineup, signaling ongoing advancements in sustainable marine technology.
energysolar-powerelectric-yachthybrid-propulsionsustainable-technologylithium-batteriesmarine-energy-systemsAmazon announces $20B nuclear-powered data center expansion in US
Amazon has announced a historic $20 billion investment to build two large data center complexes in Pennsylvania, marking the largest private sector investment in the state’s history. One complex is under construction near Philadelphia, while the other is planned adjacent to the Susquehanna nuclear power plant in northeastern Pennsylvania. Amazon intends to power the latter data center directly from the nuclear plant, a move that has drawn federal scrutiny and is currently under review by the Federal Energy Regulatory Commission (FERC). This direct power connection could provide Amazon with up to 960 megawatts—about 40% of the plant’s output—enough electricity to power over half a million homes, potentially at a premium price. The Pennsylvania governor, Josh Shapiro, emphasized that this investment aims to revitalize local communities and reverse the trend of young workers leaving the state for better opportunities. Amazon’s acquisition of the nearby data center and land from Talen Energy for $650 million last year enables the company to expand significantly on that site. This expansion is part of Amazon’s broader strategy, which has seen about $10 billion pledged in 2024 alone for data centers across several states, driven by the growing energy demands of AI technologies. However, the direct power deal raises concerns about grid fairness and energy access, as it may limit availability for others and bypass grid improvement fees, prompting ongoing regulatory review.
energynuclear-powerdata-centersAmazonenergy-infrastructurerenewable-energypower-gridSérgio Sette Câmara to Race for Nissan Formula E Team in Berlin - CleanTechnica
Brazilian driver Sérgio Sette Câmara will make his first race appearance for the Nissan Formula E Team at the Berlin E-Prix on July 12-13, 2025, stepping in for Norman Nato, who is absent due to World Endurance Championship commitments. Having debuted in Formula E in 2020 and competed in 66 races, the 27-year-old joined Nissan ahead of Season 11 as a reserve and simulator driver. This event will mark his debut in the Nissan e-4ORCE 05 car. Nissan currently holds a strong position in the championship, sitting second in the Teams’ Championship and leading the Manufacturers’ Standings with five rounds remaining. Nissan’s team principal, Tommaso Volpe, expressed confidence in Sette Câmara’s ability to adapt quickly to the unique demands of Formula E, including the car’s specific energy management and tire characteristics. Sette Câmara himself highlighted his excitement to race with a leading team and the opportunity to experience new technical elements such as the GEN3 EVO car’s all-wheel-drive system, pit-boost, and softer tire compounds. He also looks forward to partnering with teammate Oliver (Oli), from whom he hopes to learn and collaborate effectively. Nissan has been involved in Formula E since Season 5 (2018/19) and committed to the GEN3 era starting Season 9 (2022/23). The company fully acquired the e.dams team in 2022 and supplies powertrain technology to McLaren Racing for the GEN3 era. In March 2024, Nissan became the first manufacturer to commit to the GEN4 era through 2030, aligning with its Ambition 2030 electrification goals. For Season 11, Nissan’s driver lineup includes Oliver Rowland alongside reserve driver Sette Câmara.
energyelectric-vehiclesFormula-ENissanmotorsportenergy-managementelectric-racingChernobyl: Once a nuclear disaster, could turn into a tourism hub
Ukraine is pursuing a post-war restoration plan to transform the Chernobyl Exclusion Zone and the nearby city of Slavutych into sustainable international tourism and education hubs. This initiative aims to preserve the legacy of the 1986 nuclear disaster while fostering economic renewal in a region affected by both the nuclear catastrophe and recent conflict. Authorities from the Chernobyl Nuclear Power Plant and Slavutych have signed a memorandum to promote tourism that emphasizes nuclear safety, environmental recovery, and human resilience. The plan is part of Ukraine’s broader strategy to convert decades of hardship into opportunities for learning, progress, and global collaboration. Slavutych, built to house workers evacuated from Pripyat after the disaster, remains closely tied to Chernobyl’s history. The Exclusion Zone, once deemed uninhabitable due to radiation, had become a growing tourist destination before the 2022 Russian invasion, which temporarily halted visits and caused damage to critical infrastructure like the New Safe Confinement structure. Despite these challenges, Ukraine is committed to reopening the area with a focus on sustainable tourism that includes new visitor centers, improved transport, and guided tours highlighting both the environmental impact and the surprising resurgence of wildlife in the zone. Investments in Slavutych’s infrastructure, including hotel expansion, aim to support international visitors and underscore Ukraine’s resilience and recovery.
energynuclear-energyChernobylnuclear-disastersustainable-tourismenvironmental-recoveryradiation-safetyBiology-inspired solid-state battery boosts EV range to 500 miles
Researchers at Georgia Tech have developed a novel solid-state battery that blends lithium with soft sodium metal, significantly reducing the high pressure typically required for solid-state battery operation. This breakthrough addresses a major limitation of solid-state batteries, which usually need heavy and bulky metal plates to maintain pressure, making them impractical for widespread use. By incorporating sodium, which is electrochemically inactive but very soft, the battery maintains better contact with the solid electrolyte under lower pressure, enhancing performance and potentially enabling lighter, longer-lasting batteries. The team drew inspiration from biology, specifically the concept of morphogenesis, to explain how the sodium-lithium combination adapts structurally during battery use. This biological analogy helped them understand the deformable nature of sodium within the battery, which adjusts to changes and improves stability. Funded partly by DARPA, the research promises significant advancements, including electric vehicles capable of traveling 500 miles on a single charge and longer-lasting phone batteries. While commercialization challenges remain, this innovation could mark a major leap forward in battery technology by making solid-state batteries more competitive with current lithium-ion standards.
energysolid-state-batterylithium-ionsodium-lithium-batteryelectric-vehiclesbattery-technologymaterials-scienceEnergy Department Orders Michigan Coal Generating Station To Remain Open - CleanTechnica
The U.S. Energy Department, led by Chris Wright, issued an emergency order mandating that the 63-year-old J.H. Campbell coal-fired power plant in Michigan remain operational for at least 90 days, overriding a previously approved decommissioning plan set by the Michigan Public Service Commission (PSC) in 2022. The plant was scheduled to close as part of a transition plan that included replacing its capacity with a methane-fired power plant already purchased by Consumers Energy, the utility owner. Wright justified the order by citing concerns over potential electricity shortages in the Midwest during the summer due to insufficient baseload power from coal, gas, and nuclear plants. However, the Michigan PSC and the utility company stated they neither requested nor were consulted about the emergency order, highlighting a lack of coordination and transparency. The decision has drawn criticism for bypassing the usual regulatory process, which typically involves public comment and agency review, and for imposing significant financial burdens on consumers. Dan Scripps, chair of the Michigan PSC, estimated that keeping the coal plant running could cost ratepayers across 15 states tens of millions of dollars, potentially nearing $100 million. The Energy Department defended the order by referencing longstanding warnings from grid operators about the risks of decommissioning baseload power sources but did not provide evidence of a cost-benefit analysis or acknowledge the existing replacement plan. Emergency orders of this nature are described as highly unusual, underscoring the controversial and unprecedented nature of this intervention.
energycoal-powerenergy-policypower-gridelectricity-generationfossil-fuelsenergy-departmentEVs aren’t being forced on Canadians — if anything, they’re being withheld from them - Clean Energy Canada
The article from Clean Energy Canada challenges the narrative that governments are forcing Canadians to buy electric vehicles (EVs), presenting evidence that many Canadians are actually eager to adopt EVs. A recent Abacus Data survey shows that 45% of Canadians intend to purchase an EV as their next vehicle, with higher interest in urban areas and among younger demographics. Despite this demand, Canada risks falling behind global EV adoption trends due to market barriers, including a pause in national and provincial EV incentives and restrictive trade policies. A key factor limiting EV availability and affordability in Canada is the country’s protectionist stance, particularly its 100% tariff on Chinese EVs, implemented to align with U.S. policies. This tariff contrasts with Europe’s more moderate approach and has effectively blocked many lower-cost, high-quality EV models from entering the Canadian market. The article argues that openness to Chinese automakers fosters competition and innovation, benefiting consumers and accelerating EV adoption. Additionally, harmonizing vehicle approval standards with Europe could expand consumer choice by allowing popular models like the Renault 5 to enter Canada. Public opinion supports reducing tariffs and increasing EV options, with many Canadians favoring lower or no tariffs on Chinese EVs and broader market access. The article emphasizes that protecting Canadian manufacturing jobs remains important, but a balanced approach is needed—one that opens the market to more competition while investing in domestic industry and maintaining fair regulations. Measures such as price caps on EV rebates or bonus incentives for affordable EVs could further enhance accessibility. Overall, the piece highlights that Canadians are not being forced into EVs; rather, they are being underserved by a closed market that limits access to affordable and diverse electric vehicles.
energyelectric-vehiclesclean-energyautomotive-industrytariffsEV-adoptiongreen-technologyThe All-New Nissan LEAF: A Perfect Blend of Performance, Comfort, and Efficiency - CleanTechnica
The third-generation Nissan LEAF introduces significant enhancements in performance, comfort, and efficiency, highlighted in the second installment of Nissan’s LEAF Insights video series. The new model features Nissan’s all-new, compact 3-in-1 electric powertrain, which is 10% smaller than its predecessor and delivers up to 160 kW (214 hp) and 355 Nm (261 ft-lb) of torque on select variants. This powertrain, combined with a multi-link rear suspension system that increases lateral stiffness by 66%, a more rigid body structure, and the CMF-EV platform, results in improved agility, ride comfort, and a tighter turning radius of 5.3 meters despite larger 19-inch wheels. Additionally, noise and vibration reductions make the cabin up to 2 decibels quieter at urban speeds compared to the previous generation, with a redesigned HVAC unit placement enhancing interior spaciousness. Thermal management is a key focus in the new LEAF, with engineers implementing a liquid-cooled battery system that incorporates a thermal recovery feature. This system captures heat generated by the on-board charger to warm the battery, improving regeneration efficiency and maintaining optimal battery performance in cold conditions, which can help extend driving range. Overall, the integration of the advanced powertrain, thermal management, upgraded suspension, and platform improvements deliver a smooth, responsive, and energy-efficient driving experience. Further details will be revealed in the final installment of the LEAF Insights series.
energyelectric-vehiclesbattery-technologythermal-managementelectric-powertrainenergy-efficiencyautomotive-innovationOcean Protection Means Including Shipping in Countries’ Paris Climate Targets - CleanTechnica
At the 2025 UN Ocean Conference in Nice, environmental groups Opportunity Green, Seas At Risk, and Transport & Environment urged countries to include international shipping emissions in their Nationally Determined Contributions (NDCs) under the Paris Agreement ahead of COP30. They highlighted that shipping emissions represent a significant “glaring gap” in most countries’ climate plans despite falling under the Paris Agreement’s economy-wide emission coverage. The recent draft International Maritime Organization (IMO) Net-Zero Framework, pending adoption, marks a historic step by introducing the first legally binding global measure to reduce shipping greenhouse gas emissions through penalties and marine fuel standards. However, the groups emphasize that this IMO framework alone is insufficient to meet climate and equity goals without complementary national and regional policies. Incorporating shipping emissions into NDCs would provide countries with a legislative mandate to regulate and reduce the sector’s climate impact, offering certainty for industry investment in zero-emission technologies. The groups call on nations to implement policies supporting the IMO framework, promote innovation in zero-emission fuels, and assist developing countries, especially Small Island Developing States and Least Developed Countries, in meeting maritime environmental standards. Representatives stressed the urgent need for accountability and action, noting that shipping contributes significantly to ocean pollution and climate change but remains largely unregulated in national climate commitments. They argue that recognizing shipping emissions in NDCs aligns with broader ocean conservation goals and is a critical step toward meaningful climate action.
energyshipping-emissionsclimate-targetsmaritime-decarbonizationIMO-Net-Zero-Frameworkgreenhouse-gas-reductionsustainable-ocean-use3,000km EV Road Trip From Johannesburg To Simola Hillclimb To Raise EV Awareness In South Africa - CleanTechnica
The article highlights the challenges and emerging progress of electric vehicle (EV) adoption in South Africa, where high import duties, taxes, and limited BEV model availability have kept prices significantly higher than comparable internal combustion engine (ICE) vehicles. For instance, EV import taxes reach 25%, compared to 18% for ICE vehicles, and an additional ad valorem tax often doubles the cost of EVs relative to similar ICE models. This has resulted in the South African EV market being dominated by premium models, though more affordable options like the BYD Dolphin and Volvo EX30—currently the country’s bestselling BEV—are beginning to enter the market, signaling a gradual shift. To promote EV awareness and demonstrate their practicality, Ryan Jarrett undertook a 3,000 km roundtrip electric road trip from Johannesburg to the Simola Hillclimb event in a Volvo EX30. Covering multiple provinces and diverse environments, Jarrett’s journey included strategic charging stops and showcased the ease of long-distance EV travel within South Africa. The event itself featured EVs competing successfully, with some ranking among the fastest cars up the hill, underscoring the growing presence and performance of electric mobility in the country. Such initiatives aim to accelerate EV adoption by raising public awareness and confidence in electric vehicles as viable alternatives to ICE cars in South Africa.
energyelectric-vehiclesEV-adoptionbattery-electric-vehiclesclean-transportationSouth-AfricaEV-awarenessHeybike’s Father’s Day Sale: Huge Deals, Free Gear, & The Perfect Ride For Dad - CleanTechnica
Heybike is launching a major Father’s Day sale featuring significant discounts on its popular e-bike models, free bikepacking accessory gifts with every purchase, and bundled combo deals for families or riding partners. The promotion offers a range of e-bikes tailored to different riding styles, including foldable fat-tire models with powerful motors and long ranges, compact urban commuters with mid-drive motors and torque sensors, and versatile full-suspension folding bikes. Prices have been slashed substantially—for example, a folding fat-tire bike drops from $1,499 to $1,099, while an ultra-compact fat-tire model is now $999 from $1,499. Combo packages allow customers to save even more when buying two bikes together, with discounts up to $1,500. Heybike differentiates itself by providing a 30-day free trial, fast and free shipping, UL 2849 certified batteries for safety, and strong warranty coverage including a 10-year frame warranty on the Hero model. The company also offers live customer support and detailed documentation, ensuring a quality and user-friendly experience. The free “bikepacking gifts” included with each purchase—such as bags or utility kits—are intended to enhance the riding experience immediately, adding extra value beyond the discounted prices. Overall, the sale presents an attractive opportunity to purchase reliable, well-supported e-bikes suited for adventure, commuting, or city riding, making it an ideal time to find the perfect ride for Dad or yourself.
energye-bikeelectric-bikebattery-technologysustainable-transportationelectric-motorurban-mobilityCanada can build for the present and future, but not the past - Clean Energy Canada
Rachel Doran, executive director of Clean Energy Canada, responded to the Canadian government's introduction of the "One Canadian Economy" bill, which aims to remove internal trade barriers and promote national interest projects to strengthen the economy, diversify trade, and boost productivity and resilience. Doran emphasized that in light of geopolitical challenges, Canada must prioritize building a clean economy to seize opportunities in the global energy transition. She highlighted the importance of focusing on clean growth when identifying priority projects and removing interprovincial trade barriers, noting that investment in clean technologies is surpassing that in fossil fuels globally. Doran praised the Free Trade and Labour Mobility in Canada Act for addressing barriers to interprovincial trade and labour mobility but stressed that workers essential to clean economy projects—such as engineers, EV mechanics, and wind turbine technicians—should be prioritized. She also called for harmonizing building codes to improve energy efficiency and electricity interconnections. The inclusion of clean growth and climate objectives in the Building Canada Act was welcomed, with success depending on factors like Indigenous leadership and climate goals. Overall, Doran urged the government to focus on building a clean economy that enhances affordability and competitiveness, asserting that Canada must build for the present and future rather than trying to rebuild the past. Key points of Bill C-5 include criteria for national interest projects: strengthening Canada’s autonomy and security, providing economic benefits, ensuring project success likelihood, advancing Indigenous interests, and contributing to clean growth and climate objectives. Notably, all of Canada’s ten largest non-U.S. trade partners have net-zero commitments and carbon pricing, with many implementing carbon border adjustments and domestic EV mandates, underscoring the imperative for Canada to align its economic strategy with global clean energy trends.
energyclean-energyenergy-transitionclean-technologiesenergy-efficiencyclimate-changesustainable-growthClimeFi Unlocks Access To XPRIZE Winners With New Carbon Removal Portfolio Offering - CleanTechnica
ClimeFi has launched a new carbon removal portfolio that grants corporate buyers, climate investors, and procurement managers streamlined access to a diversified selection of carbon dioxide removal (CDR) technologies. These technologies were vetted and recognized through the XPRIZE Carbon Removal competition, which evaluated over 1,300 global teams and awarded top prizes to breakthrough projects such as Mati Carbon’s Enhanced Rock Weathering, NetZero’s Biomass CDR and Storage, Vaulted Deep’s underground waste storage, and UNDO Carbon’s Enhanced Rock Weathering. Together, these projects represent promising, scalable pathways for permanent atmospheric CO₂ removal. The ClimeFi portfolio offers a simplified, efficient procurement process by providing a single point of access to multiple validated technologies, pre-negotiated contracts, and lower minimum purchase thresholds, aiming to deliver over 50,000 tonnes of carbon removal by 2030. This approach addresses the growing demand for credible, durable, and auditable carbon credits in the maturing voluntary carbon market, combining rigorous scientific validation with commercial readiness. The collaboration between ClimeFi and XPRIZE exemplifies how competitions and asset management platforms can work together to scale global carbon removal solutions by connecting capital with vetted, investable projects.
energycarbon-removalclimate-technologysustainabilitycarbon-captureclean-energyenvironmental-technologyBeewise brings in $50M to expand access to its robotic BeeHome - The Robot Report
Beewise Inc., a climate technology company specializing in AI-powered robotic beekeeping, has closed a $50 million Series D funding round, bringing its total capital raised to nearly $170 million. The company developed the BeeHome system, which uses artificial intelligence, precision robotics, and solar power to provide autonomous, real-time care to bee hives. This innovation addresses the critical decline in bee populations—over 62% of U.S. colonies died last year—threatening global food security due to bees’ essential role in pollinating about three-quarters of flowering plants and one-third of food crops. BeeHome enables continuous hive health monitoring and remote intervention by beekeepers, resulting in healthier colonies, improved crop yields, and enhanced biodiversity. Since its 2022 Series C financing, Beewise has become a leading global provider of pollination services, deploying thousands of AI-driven robotic hives that pollinate over 300,000 acres annually for major growers. The company has advanced its AI capabilities using recurrent neural networks and reinforcement learning to mitigate climate risks in agriculture. The latest BeeHome 4 model features Beewise Heat Chamber Technology, which eliminates 99% of lethal Varroa mites without harmful chemicals. The new funding round, supported by investors including Fortissimo Capital and Insight Partners, will accelerate Beewise’s technological innovation, market expansion, and research efforts to further its mission of saving bees and securing the global food supply.
roboticsartificial-intelligenceautonomous-systemsenergyagriculture-technologymachine-learningclimate-technologyWorld's biggest electric ferry to connect Finland and Estonia by the 2030s
Finnish shipping company Viking Line has unveiled plans for Helios, the world’s largest fully electric passenger-car ferry, designed to operate emission-free between Helsinki and Tallinn by the 2030s. Measuring 640 feet long and 98 feet wide, Helios will carry up to 2,000 passengers, 650 cars, and two kilometers of freight. Powered entirely by batteries with a capacity of 85 to 100 megawatt-hours—several times larger than any existing passenger ship’s battery—the ferry will complete the 43-nautical-mile crossing in just over two hours at 23 knots. The vessel will recharge at ports using over 30 MWh of power per docking, supported by infrastructure upgrades underway at the Port of Helsinki. Helios is part of the FIN-EST Green Corridor initiative, aiming to establish a fully emission-free maritime route between Finland and Estonia. Viking Line, which has a history of maritime innovation including LNG/biogas-powered Viking Grace and the climate-smart Viking Glory, plans to order two such electric ships to double capacity on this busy route. Passenger traffic between Helsinki’s West Harbor and Tallinn is projected to more than double by 2040, with cargo volumes also rising significantly. Viking Line’s CEO Jan Hanses emphasized that emission-free technology is essential to meet growing demand while complying with tightening EU emissions regulations and rising carbon costs, marking a new era in sustainable maritime transport.
energyelectric-ferrymaritime-transportbattery-technologysustainable-shippinggreen-energyemission-free-transportation10 nuclear reactors to power 500,000 US homes with 1,000MW output
The article discusses Westinghouse’s plan to deploy 10 large-scale nuclear reactors in the US, each with a 1,000 MW output, aiming to power approximately 500,000 homes. This initiative aligns with former President Donald Trump’s executive orders issued in May 2023, which call for quadrupling US nuclear capacity by 2050 and initiating construction of 10 full-sized reactors by 2030. Westinghouse, leveraging its AP1000 pressurized water reactor design—already licensed and operational globally—is positioned as the primary candidate to fulfill this mandate. The company highlights its modular construction expertise, a stable supply chain, and lessons learned from previous projects, including the Vogtle site in Georgia and deployments in China, as key advantages. Discussions with the US Department of Energy’s Loan Programs Office are ongoing to secure necessary financing. The estimated cost for building these reactors could reach $75 billion, excluding potential overruns, which remains a significant hurdle given the US utilities’ cautious stance after past cost escalations. Westinghouse faces limited competition in the large reactor market due to political and strategic factors sidelining foreign vendors and other domestic companies focusing on small modular reactors (SMRs). Meanwhile, SMR developers like NuScale and Holtec International are gaining attention by promoting smaller, modular units that can be co-located to match the output of large reactors with potentially lower costs and faster construction timelines. Despite the executive order’s emphasis on large reactors, SMRs are emerging as a competitive alternative in the evolving US nuclear energy landscape.
energynuclear-reactorsWestinghouseUS-energy-policymodular-constructionAP1000-reactornuclear-capacity-expansionEnergy Drive Secures £20m Investment From Pears Family - CleanTechnica
Energy Drive, a company specializing in industrial energy efficiency, has secured a £20 million investment from the Pears Family. This funding will be used to partially buy back stakes from some founding shareholders and a South African private equity investor, as well as to support the company’s expansion into European and North American markets. Energy Drive focuses on optimizing industrial motors—particularly large fans and pumps—by deploying variable speed drives and intelligent motor controls that reduce energy consumption by an average of 43%. Their systems are installed and operated as-a-service, with Energy Drive owning and maintaining the equipment, thus eliminating capital expenditure and maintenance costs for clients. The company’s technology significantly cuts emissions, saving nearly one million kilograms of CO2, SO2, and NOx annually. Energy Drive currently operates over 250 systems worldwide across industries such as mining, metals, manufacturing, chemicals, and utilities, partnering with major firms like ArcelorMittal and Liberty Steel. Their solutions optimize the performance of medium and low voltage industrial motors by matching motor speed to operational needs, monitored remotely 24/7 and verified by independent third parties. This approach ensures guaranteed energy savings and supports the global drive toward industrial energy efficiency without upfront costs for clients.
energyindustrial-motorsenergy-efficiencyvariable-speed-drivesemissions-reductionenergy-storageindustrial-technologyThis YouTuber doubled his Nissan Leaf’s range with a DIY battery swap
YouTuber Battery Man successfully upgraded a first-generation Nissan Leaf by swapping its original 30 kWh battery with a larger 62 kWh battery from a second-generation model. This DIY retrofit more than doubled the car’s range from 107 miles (172 km) to 228 miles (366 km) on a full charge. The process took about three hours using basic home tools such as hydraulic jacks, jack stands, and a welder for minor fabrication, including creating metal brackets and extending existing ones to fit the bigger battery. In addition to the battery swap, Battery Man installed new rear springs, bolts, a pyro fuse, an OBD reader, and a CAN bridge to enable communication between the new battery and the older vehicle’s systems. The total cost for the upgrade was approximately £3,200 ($4,340), making it an affordable option for EV enthusiasts willing to undertake some software adjustments and mechanical work. Battery Man emphasized the Nissan Leaf’s adaptable design, likening it to a Lego car, and expressed optimism that DIY battery swaps like this could become more common in the future.
energyelectric-vehiclesbattery-swapDIYNissan-LeafEV-range-upgradebattery-retrofitWorld's widest burning gas crater is finally starting to die out
The Darvaza Gas Crater, also known as the "Door to Hell," is a massive natural gas fire in Turkmenistan's Karakum Desert that has been burning continuously since 1971. It originated when Soviet geologists accidentally drilled into an underground gas pocket and ignited it intentionally to prevent the release of toxic gases. Expected to burn out within weeks, the crater's flames have persisted for over 54 years, consuming millions of cubic meters of natural gas annually. The crater measures approximately 230 feet wide and 100 feet deep, with temperatures exceeding 1,832°F (1,000°C), and has become a notable tourist attraction drawing over 10,000 visitors each year. Recent reports from Turkmengaz, Turkmenistan’s state gas company, indicate that the crater's flames have significantly weakened as most of the flammable gas has been depleted. At a scientific conference in Ashgabat in June 2025, researchers revealed that the fire’s intensity has dropped to about a third of its original size, with flames now only visible up close rather than from miles away. Efforts to contain methane emissions by drilling wells around the site have contributed to this decline. This development may finally address long-standing concerns about the loss of valuable natural gas and environmental impacts, marking a potential end to one of the world's longest-burning gas fires.
energynatural-gasmethanegas-craterhydrocarbon-developmentemissions-reductionenergy-transitionRenewables Surge in South Korea as New Government Charts Electrified Future - CleanTechnica
South Korea’s new government has initiated a significant policy shift toward an electrified, decarbonized energy future, emphasizing a pragmatic and economically strategic expansion of renewable energy. The plan maintains nuclear power at current levels to provide stable baseload electricity while accelerating the phase-out of coal. This approach addresses South Korea’s historical vulnerability due to its heavy reliance on imported fossil fuels—over 90% of its energy needs—which exposed the country to geopolitical risks and price volatility. The government’s vision centers on leveraging domestic renewable resources, particularly offshore wind and solar photovoltaic (PV) power, to reduce dependence on imports and environmental impacts. The envisioned energy system aims to deliver approximately 924 terawatt-hours (TWh) annually—matching current energy service levels but with far greater efficiency and lower emissions. Offshore wind is poised to be the cornerstone of this transformation, capitalizing on South Korea’s favorable maritime geography, especially in the Yellow Sea and near Jeju Island, where strong, stable winds can generate hundreds of TWh per year. This shift also aligns with industrial policy by enabling major shipbuilding companies like Hyundai Heavy Industries and Doosan to transition into offshore wind turbine manufacturing, promising significant economic benefits. Solar PV complements offshore wind by focusing on rooftop installations and floating solar farms, addressing land constraints while expanding renewable capacity. Overall, South Korea’s energy transition reflects a balanced, economically grounded strategy that integrates renewables and nuclear power to enhance energy security, reduce emissions, and foster industrial innovation. While nuclear remains a key baseload source, the emphasis on offshore wind and solar PV marks a decisive move away from fossil fuels, aiming for a more resilient, efficient, and sustainable energy system.
energyrenewable-energySouth-Koreaelectrificationoffshore-windsolar-photovoltaicnuclear-energyXi Jinping’s Carmaker Adds More Luxury EVs to Its Philippine Lineup - CleanTechnica
Hongqi, the prestigious Chinese carmaker favored by President Xi Jinping, has expanded its presence in the Philippines by opening a fourth dealership and introducing two new luxury electric vehicles (EVs): the EH7 sedan and the EHS7 midsize SUV. Since its Philippine debut in 2023, Hongqi has established four showrooms in upscale areas, including a new location near Manila Bay. The brand emphasizes imposing, luxurious designs that reflect power and status, blending sleek, minimalist lines with youthful sophistication to appeal to consumers valuing both form and function. The new EVs come in two variants: the Executive, featuring an 85 kWh battery with rear-wheel drive producing 253 hp and 450 Nm torque, and the Flagship, equipped with a 111 kWh battery and dual-motor all-wheel drive delivering 610 hp and 756 Nm torque. The vehicles offer impressive ranges—up to 403 miles for the EH7 sedan and 335 miles for the EHS7 SUV on a full charge—and fast-charging capabilities that replenish 10% to 80% battery in 20 minutes. Both models boast luxury features such as hand-stitched Nappa leather seats, panoramic UV-protected glass roofs, acoustic glass for quiet rides, and advanced suspension systems for smooth handling on rough roads. Safety is rated 5 stars by Euro NCAP, and Level 2 advanced driver assistance systems include emergency braking and 360-degree cameras. Pricing ranges from approximately $40,100 to $55,160 depending on model and variant.
energyelectric-vehiclesEV-batteryfast-chargingluxury-EVautomotive-technologyelectric-drivetrainChina's new deep-ocean drilling vessel aims to go beyond Earth's crust
China has launched the Meng Xiang, its first domestically designed and built deep-ocean drilling vessel, capable of drilling up to 11 kilometers (6.8 miles) beneath the ocean floor. Officially commissioned in November 2024 in Guangzhou, the vessel is set to begin drilling operations in the South China Sea later in 2025, continuing through 2035. The Meng Xiang aims to advance understanding of the Earth’s deep interior, particularly the boundary between the crust and mantle known as the Mohorovičić discontinuity (Moho), which has previously been studied mainly through indirect methods like seismology and volcanic mineral analysis. The Meng Xiang is China’s largest scientific research vessel, measuring nearly 180 meters in length and displacing 42,600 tonnes. It features a first-of-its-kind hydraulic lifting rig capable of both oil and gas exploration and scientific core sampling, supporting four drilling modes and three coring methods to accommodate diverse geological conditions. The ship can operate unassisted for 120 days, has a range of 15,000 nautical miles, and houses nine advanced laboratories covering fields such as geology, geochemistry, microbiology, and ocean science. Additionally, it includes the world’s first automated shipborne core sample storage system and is engineered to withstand super typhoons, ensuring safe operation in extreme sea conditions. This vessel represents a significant step forward in marine science and technology, offering unprecedented opportunities to study the Earth’s deep ocean and interior.
energydeep-ocean-drillingscientific-research-vesseloil-and-gas-explorationnatural-gas-hydratehydraulic-lifting-rigmarine-technologyWomen Live In Ways That Emit Less Carbon Than Men - So What? - CleanTechnica
The article from CleanTechnica discusses the gender differences in carbon footprints, highlighting that women generally have lower carbon emissions than men due to differences in consumption patterns, particularly in diet and transportation. It emphasizes that mitigating climate change requires changes in personal consumption, especially in high-emission sectors such as food choices and commuting methods. For example, in France, diet and transport account for about half of an individual's carbon footprint, with men’s higher emissions largely driven by greater consumption of red meat and more frequent use of cars. The study cited suggests that if all men adopted women’s consumption habits without reducing women’s, significant reductions in carbon emissions could be achieved, particularly in food (1.9 MtCO2e) and transport (11.5 MtCO2e). The article contrasts the US and France, noting that the average American’s carbon footprint (about 16 tons/year) is substantially higher than that of the average French person (9.2 tons/year), partly due to cultural norms that promote consumption as a status symbol, especially among men. This includes preferences for muscle cars and frequent upgrades of technology, which contribute to excessive emissions. Indoor energy use, such as air conditioning and fuel-burning appliances, also plays a significant role in the US carbon footprint. The article also points out that household structure influences emissions, with couples and families showing different patterns in food and transport footprints. Overall, the findings imply that climate policies should consider gender and social roles, as women’s consumption patterns may be more aligned with net-zero goals, while men may face greater behavioral and cultural barriers to reducing emissions.
energycarbon-footprintclimate-changegreenhouse-gas-emissionsconsumption-patternstransportation-emissionsenergy-consumptionZeekr hybrid EV with twin electric motors charges 20% to 80% in 9 mins
The Zeekr 9X, a flagship plug-in hybrid SUV from Geely-owned Zeekr, is set to launch in China in Q3 2025. Positioned as a premium full-size SUV, the 9X features a 900V electrical system combined with a 2.0-liter turbocharged engine and dual electric motors delivering all-wheel-drive performance. Its powertrain includes a front motor producing 290 kW and a rear motor with 370 kW, supported by a high-performance 6C Qilin ternary NMC battery from CATL, offering an electric range of approximately 236 miles. Notably, the 900V system enables ultra-fast charging from 20% to 80% in just 9 minutes. The vehicle also incorporates ergonomic and safety innovations such as a steering column-mounted electronic gear selector with an integrated driver monitoring system and a roof-mounted LiDAR sensor for advanced driver assistance. The Zeekr 9X is equipped with the G-Pilot H9 advanced driving assistance system, powered by dual Nvidia Drive Thor chips delivering a combined 1,400 TOPS, surpassing Tesla’s AI 4 chip. This system includes 13 cameras, three millimeter-wave radars, and multiple LiDAR units to enable high-level autonomous driving capabilities. The SUV also features a dual-chamber air suspension with continuous damping control, allowing ride height adjustment up to 110 mm and a maximum ground clearance of 288 mm, enhancing both comfort and off-road performance. With a bold design inspired by the Zeekr 009 minivan and distinctive lighting elements, the 9X aims to compete with luxury SUVs like the YangWang U8. Zeekr, launched in 2021 as Geely Group’s premium new energy vehicle brand, has rapidly grown its market presence with six models and strong sales, reaching 71,640 vehicles sold in the first five months of 2025. The 9X represents the brand’s strategic move into the high-end SUV segment, combining cutting-edge technology, performance, and luxury features to challenge established competitors in China’s evolving EV market.
energyelectric-vehicleshybrid-technologybattery-technologyfast-chargingautomotive-materialsadvanced-driver-assistance-systemsVinfast EV Taxis Now in Manila - CleanTechnica
Vietnamese company Green & Smart Mobility (GSM), founded by VinFast CEO Pham Nhat Vuong, has launched a fleet of VinFast VF e34 electric taxis in Manila, marking the Philippines as the fourth Southeast Asian country to receive these EV taxis after Vietnam, Laos, and Indonesia. GSM aims to improve the local taxi industry's poor reputation, which suffers from old vehicles, unsafe conditions, and corrupt drivers. The company employs drivers as full-time staff with fixed salaries and incentives, rather than the traditional commission-based system, and offers an app for easy booking alongside street hails. GSM also partners with Manila’s largest taxi company, R&E Taxi, and has installed over 30 charging stations at R&E’s compound. The chosen vehicle, the VinFast VF e34, is a compact electric SUV with a 41.9 kWh battery, delivering 147 hp and a 197-mile (318 km) range, suitable for up to 10 hours of continuous driving in Manila. It features advanced safety equipment including six airbags, ABS with EBD, vehicle stability control, and a 360-degree camera system. GSM taxis are painted in a distinctive “Nerio Green” color. A standout feature is the S2S (Secure to Safe) AI-powered monitoring system developed by VinAI, which uses interior and exterior cameras to detect threats or emergencies, especially during high-risk night hours, and alerts a 24/7 operations center. The system complies with Philippine data privacy laws by encrypting footage and deleting it after 48 hours. In summary, GSM’s introduction of VinFast electric taxis in Manila represents a significant effort to modernize and clean up the city’s taxi services through electric vehicles, improved driver conditions, advanced safety features, and AI-driven security monitoring. This initiative aligns with broader regional adoption of VinFast EV taxis and reflects a push toward eco-friendly, reliable, and safer urban transportation in the Philippines.
energyelectric-vehiclesEV-taxislithium-ion-batterycharging-stationssustainable-transportationVinFastEVs Take 33.7% Share Of The UK - BYD Dolphin Surf Arrives! - CleanTechnica
In May 2024, plugin electric vehicles (EVs) captured a significant 33.7% share of the UK auto market, up from 25.7% year-on-year. Battery electric vehicles (BEVs) accounted for 21.8% of sales, growing 26% YoY, while plug-in hybrid electric vehicles (PHEVs) made up 11.9%, with a 51% increase. Hybrid electric vehicles (HEVs) saw modest growth, whereas combustion-only vehicles declined despite a slight overall market increase. Year-to-date, plugin EVs hold a 30.9% market share, with BEVs comprising over two-thirds of these sales. Notably, petrol-only vehicles have held under 50% market share for four consecutive months, and diesel-only vehicles remain below 6%. Analysts suggest that combined plugin EV sales might surpass combustion-only sales by December 2024 for the first time. Volkswagen led the BEV market in May with 11.5% share, driven by models like the ID.4 and ID.7, followed by BMW and Audi. Tesla, previously the top seller, dropped to fourth place in May but showed signs of recovery with the arrival of the Model Y, capturing over 21% of the UK BEV market in early June. New model launches are reshaping the market, with the Skoda Elroq performing strongly since its March debut, and the Ford Puma showing growth after its April launch. In the affordable small EV segment, the Renault 5 leads, with the BYD Dolphin Surf entering the UK market in May, signaling increased competition. This growing diversity and affordability in EV options bode well for consumer choice and market growth.
energyelectric-vehiclesBEVPHEVUK-auto-marketVolkswagenTeslaEV Charging Stakeholders Play The Long Game In US
The article discusses the current challenges and ongoing efforts in the US electric vehicle (EV) market, particularly focusing on the EV charging infrastructure and user experience. Despite a recent decline in enthusiasm for EV sales—highlighted by a AAA survey where over half of respondents cited inconvenient public charging stations and range anxiety as key deterrents—industry stakeholders remain optimistic about the long-term shift away from gasoline-powered vehicles. A significant development is the collaboration between Blink Charging Co. (a US manufacturer), ChargeHub (a Canadian charging app company), and WirelessCar (a Swedish telematics firm) to launch a “Seamless Charging” pilot project. This initiative aims to simplify the charging process by enabling drivers to use any Blink charging station with a single app registration, eliminating the need for multiple apps, cards, or complicated steps, thereby addressing a major barrier to EV adoption. WirelessCar, a lesser-known but influential player in automotive telematics, supports this effort with its extensive experience in vehicle connectivity, serving major automakers worldwide. Founded in 1999, WirelessCar has evolved from emergency services like Volvo On Call to broader telematics solutions that now emphasize electrification, safety, and autonomous driving technologies. The company’s involvement in the Seamless Charging project underscores the growing importance of integrated digital services in enhancing the EV ownership experience. Overall, while current EV sales face headwinds, these collaborative technological advancements in charging infrastructure and app usability are designed to improve convenience and reduce consumer concerns, potentially accelerating the transition to electric mobility in the US and Canada.
energyelectric-vehiclesEV-chargingcharging-appsseamless-chargingBlink-ChargingtelematicsSolid-state battery breakthrough promises 50% more range in one charge
Researchers from Skolkovo Institute of Science and Technology (Skoltech) and the AIRI Institute have achieved a significant breakthrough in solid-state battery technology by using machine learning to accelerate the discovery of high-performance battery materials. Their innovation could enable electric vehicles (EVs) to travel up to 50% farther on a single charge while improving safety and battery lifespan. The team employed graph neural networks to rapidly identify optimal materials for solid electrolytes and protective coatings, overcoming a major hurdle in solid-state battery development. This approach is orders of magnitude faster than traditional quantum chemistry methods, enabling quicker advancement in battery design. A key aspect of the research is the identification of protective coatings that shield the solid electrolyte from reactive lithium anodes and cathodes, which otherwise degrade battery performance and increase short-circuit risks. Using AI, the team discovered promising coating compounds such as Li3AlF6 and Li2ZnCl4 for the solid electrolyte Li10GeP2S12, a leading candidate material. This work not only enhances the durability and efficiency of solid-state batteries but also paves the way for safer, more durable, and higher-performing EVs and portable electronics, potentially reshaping the future of energy storage.
energysolid-state-batterybattery-materialselectric-vehiclesmachine-learningneural-networksenergy-storageTransforming Canada: Mapping A 100% Electrified Energy Economy - CleanTechnica
The article "Transforming Canada: Mapping A 100% Electrified Energy Economy" explores Canada’s critical juncture in transitioning its energy system toward full electrification and renewable integration. Drawing on the author's experience with Ireland’s 2050 energy roadmap and collaboration with Canadian energy leaders, the piece highlights the opportunity for Canada to adopt a similarly ambitious, clean, secure, and affordable energy framework. Despite differences in scale, Canada and Ireland share challenges like decarbonization, energy independence, and affordability. Canada’s abundant renewable resources and technological capacity position it well for this transformation. Currently, Canada’s energy system is heavily reliant on fossil fuels, primarily oil and natural gas exports to the U.S. and increasingly Asia, which creates economic vulnerabilities amid global market and geopolitical uncertainties. Domestically, fossil fuels dominate heating, transportation, and industry, resulting in significant inefficiencies and energy waste—about 1,500 TWh of the roughly 2,500 TWh primary energy consumed annually is lost, mainly as waste heat from combustion processes. The author presents Sankey diagrams illustrating current energy flows and envisions a fully decarbonized, electrified Canadian energy economy. While the diagrams are preliminary, they underscore the scale of inefficiency in the current system and the potential gains from electrification and renewable integration. The article serves as an initial reflection and call to action for inclusive, forward-looking energy planning in Canada.
energyrenewable-energyelectrificationdecarbonizationenergy-policyclean-energyenergy-transformationTrump administration takes aim at Biden and Obama cybersecurity rules
The Trump administration has issued an executive order that significantly revises and rolls back several cybersecurity policies established by former Presidents Barack Obama and Joe Biden. The administration criticized Biden’s recent cybersecurity order, particularly opposing its encouragement for agencies to accept digital identity documents for public benefit programs, citing concerns about potential abuse by illegal immigrants. Experts like Mark Montgomery argue that revoking digital ID mandates prioritizes immigration concerns over cybersecurity benefits. The new order also shifts the federal AI cybersecurity strategy to focus on identifying and managing vulnerabilities rather than censorship, promotes AI use in defending energy infrastructure and Pentagon cybersecurity, and supports federal AI security research. Additionally, the order removes previous requirements for agencies to adopt quantum-resistant encryption promptly and eliminates mandates for federal contractors to attest to software security, labeling these as burdensome and ineffective compliance measures. It also repeals Obama-era policies that allowed sanctions for cybersecurity attacks, restricting sanctions only to foreign malicious actors to avoid misuse against domestic political opponents and clarify that election-related activities are exempt. Overall, the Trump administration’s changes reflect a move away from some compliance-heavy and expansive cybersecurity measures toward a narrower, security-focused approach with an emphasis on AI and foreign threats.
energycybersecurityAI-securityquantum-resistant-encryptionfederal-researchenergy-infrastructurecybersecurity-policy230 giant viruses discovered with surprising effects on ocean health
Researchers at the University of Miami’s Rosenstiel School of Marine, Atmospheric and Earth Science have discovered 230 new giant viruses in the ocean, along with 530 new proteins, including nine associated with photosynthesis. These findings suggest that giant viruses can interfere with their hosts’ energy conversion processes, particularly in key marine microorganisms like algae, amoebas, and flagellates that form the base of the oceanic food chain. The study highlights the significant impact these viruses have on marine ecosystems, including their potential role in harmful algal blooms that affect human health globally. To identify these viruses, the team developed a novel computational tool called BEREN, which improved detection and classification of giant viruses from vast DNA sequencing datasets collected from nine major ocean sampling projects worldwide. Analysis revealed that these viruses carry genes involved in critical cellular functions such as carbon metabolism and photosynthesis, indicating they can alter host metabolism and influence marine chemical cycles. The research, published in npj Viruses, not only expands understanding of viral diversity and function in ocean ecosystems but also offers new avenues for monitoring environmental health and biotechnological applications.
energymarine-biologyphotosynthesisocean-virusesbiotechnologyenvironmental-scienceviral-genomicsOur Problem Politically: We No Longer Focus On The Greater Good - CleanTechnica
The article from CleanTechnica argues that a fundamental political problem in the US today is the lack of focus on the greater good, with society and government failing to provide appropriate oversight to address collective challenges like climate change. The author highlights the irony of insurance companies refusing to cover homes at climate risk while insuring fossil fuel projects, underscoring a broader societal failure to prioritize long-term communal welfare over short-term individual or corporate gain. The erosion of trust and effectiveness in government further hampers efforts to regulate and transition away from fossil fuels, as government itself has become a divisive and often distrusted institution. The piece reflects on how political discourse has shifted from collective action and shared sacrifice—seen in historical movements like WWII, Civil Rights, and women’s suffrage—to a more selfish, fear-driven narrative focused on personal gain, scapegoating, and division. The author laments that today’s politics rarely start from the question, “How do we help society as a whole?” Instead, the prevailing mindset is “What’s in it for me?” This shift toward individualism and greed has weakened societal cohesion and the ability to address pressing issues like climate collapse effectively. The article calls for a renewed emphasis on common ground and the greater good as the foundation for political and social progress.
energyfossil-fuelsclimate-changegovernment-policysustainabilityenvironmental-oversightclean-energyMore Bad News For Tesla, EV Charging Edition
The article discusses recent challenges and shifts in the U.S. electric vehicle (EV) charging landscape, highlighting setbacks for Tesla alongside emerging competitors. Early in the year, the Biden administration canceled federal funding for public EV charging stations, casting uncertainty over the EV sales environment. Tesla, long considered the industry leader with its proprietary Supercharger network, has faced brand reputation issues partly due to CEO Elon Musk’s controversial decisions, including significant staff changes in the charging division. Notably, the New Jersey Turnpike Authority replaced Tesla Superchargers at key service areas with Universal Open Access chargers from Dublin-based Applegreen Electric, signaling a shift away from Tesla’s exclusive network. Applegreen Electric is aggressively expanding its footprint in the U.S., securing contracts beyond New Jersey, including with the Pennsylvania Department of Transportation for the Pennsylvania Turnpike. Despite federal funding cuts, several states had already secured funding before the cancellation, allowing Applegreen to win most contracts for new chargers along major highways like I-76. The article also notes Tesla’s missed opportunities in the electrification market, such as delays in launching electric trucks and neglecting the convenience store (c-store) segment, which integrates EV charging with traditional fuel stops and amenities. Applegreen’s parent company is capitalizing on this by installing EV chargers at numerous convenience and fuel stations across the Midwest, Northeast, and parts of the Southeast, positioning itself as a key player in the evolving EV infrastructure ecosystem.
energyelectric-vehiclesEV-charging-stationsTeslarenewable-energytransportation-infrastructureclean-technologyInsurance Companies Cancelling Home Owner Insurance Are Supporting LNG Terminals - CleanTechnica
The article highlights a stark contradiction in the behavior of major insurance companies in the United States. While these insurers are increasingly canceling homeowner insurance policies in many areas due to climate-related risks, they continue to provide coverage for liquefied natural gas (LNG) terminals, particularly in regions like the Gulf Coast from Port Arthur, Texas, to Lake Charles, Louisiana. These areas, predominantly inhabited by Black, Brown, and low-income communities, have become "sacrifice zones"—highly polluted and environmentally degraded regions where marginalized populations disproportionately suffer health and environmental harms. The insurance companies, motivated by substantial profits from LNG projects, are criticized for ignoring the ethical implications of supporting fossil fuel infrastructure that exacerbates climate change and environmental racism. The article draws on data from the Rainforest Action Network, which identifies insurers such as Chubb, AIG, Allianz, Liberty Mutual, Munich Re, Swiss Re, Zurich, Tokio Marine, and The Hartford as key backers of LNG projects like Cameron LNG. Additionally, major financial institutions including JPMorgan, Citi, BlackRock, and Vanguard have funded these fossil fuel expansions. Community organizers and activists, such as Roishetta Ozane from Lake Charles, emphasize the direct health impacts on local residents and link these to broader climate crises driven by fossil fuel emissions. They argue that while insurance companies refuse to cover vulnerable homeowners facing climate threats, they paradoxically insure and finance projects that perpetuate environmental injustice. The activists call for public pressure on insurers and financiers to address this hypocrisy and reconsider their role in supporting environmentally and socially harmful industries.
energyLNG-terminalsfossil-fuelsenvironmental-impactinsurance-industryclimate-riskpollutionChinese carmaker unveils enhanced hybrid EV with 870-mile range
Chinese automaker Chery has unveiled the 2025 model of its Fulwin A8 mid-sized hybrid sedan in five variants, including a new version offering a 43-mile pure electric range. Powered by a 1.5-liter high-efficiency hybrid engine combined with an advanced hybrid system, the Fulwin A8 delivers a total driving range exceeding 870 miles (1,400 km) and a combined fuel consumption of about 51.8 mpg (WLTC). The vehicle features a continuously variable super hybrid DHT transmission with peak mechanical efficiency of 98.5%, supporting four driving modes—Pure Electric, Series Hybrid, Parallel Hybrid, and Direct Engine Drive—to optimize performance and fuel economy. It also includes Level 2 advanced driver assistance with 19 functions for enhanced safety. Inside, the Fulwin A8 boasts a family-friendly dual-screen layout centered around the Lion 5.0 AI smart cockpit system, powered by a Snapdragon 8155 processor. The system runs on a 24.6-inch dual-screen display with rapid 2-second boot-up, supporting wireless Apple CarPlay and Huawei HiCar for seamless smartphone integration. Positioned as the flagship of Chery’s new energy vehicle lineup launched in late 2023, the Fulwin A8 competes with models like the BYD Qin PLUS DM-i and Geely Galaxy L6. Chery reported strong growth in 2024, with global sales reaching 2.6 million vehicles—a 38% increase year-on-year—and plans to invest further in R&D, production upgrades, and global expansion to strengthen its market presence.
energyhybrid-electric-vehicleAI-smart-cockpitSnapdragon-8155advanced-driver-assistancefuel-efficiencyautomotive-technologyDissolvable battery developed, generates electricity for over 100 mins
Researchers at Binghamton University have developed a dissolvable battery powered by probiotics—live microorganisms commonly found in yogurt and health supplements—that can generate electricity for over 100 minutes before harmlessly dissolving into the environment. This innovation addresses a major challenge in transient or bioresorbable electronics, which require power sources that disintegrate without leaving toxic residues. Unlike conventional lithium-ion batteries, which contain harmful materials, this biobattery uses a 15-strain probiotic blend on water-soluble or pH-responsive substrates, enabling controlled power delivery ranging from 4 minutes to over 100 minutes. A single module produces 4 µW of power, 47 µA of current, and an open-circuit voltage of 0.65 V. The research team, led by faculty member Choi from the Thomas J. Watson College of Engineering and Applied Science, drew on two decades of work on disposable “papertronics” and biobatteries. They engineered porous, polymer- and nanoparticle-enhanced electrodes to optimize the electrogenic capability of the probiotics, ensuring safe and efficient electricity generation. This breakthrough paves the way for new applications in biomedical implants, environmental sensors, and disposable electronics that require safe, transient power sources. The study highlights the potential for bioenergy systems that dissolve without environmental harm, fulfilling a vision similar to the self-destructing devices popularized in fiction like the Mission: Impossible films.
energybattery-technologybioelectronicstransient-electronicsprobioticsmicrobial-fuel-cellsbiodegradable-batteriesUS' interceptor with solid motor can perform better against threats
The U.S. Army’s Next-Generation Short-Range Interceptor (NGSRI), developed by Raytheon and Northrop Grumman, has successfully undergone multiple tests of its solid rocket motor technology, known as Highly Loaded Grain (HLG). This advanced solid propellant offers longer burn times and greater energy output than conventional motors, enabling the missile to fly faster, extend its range, and perform more effectively against advanced aerial threats. The program has completed three static firings in varied environments and a successful ballistic flight demonstration, with further tests planned soon. The missile’s design allows it to be launched from various platforms, including tripods, vehicles, and shoulder launchers. Raytheon and Northrop Grumman’s collaboration has rapidly transitioned the HLG motor from concept to flight-ready status in under six months, leveraging modular design and automated manufacturing techniques. This propulsion innovation enhances speed, range, and mission flexibility in a compact form factor, marking a significant advancement over legacy air defense systems. The NGSRI builds on over 60 years of air defense expertise to deliver a highly capable shoulder-launched missile for the U.S. Army and Marine Corps, aiming to protect warfighters against evolving airborne threats with cutting-edge technology.
energysolid-rocket-motormissile-technologypropulsion-systemsdefense-technologyRaytheonNorthrop-GrummanVanguard-Class: Britain’s Silent Nuclear Guardians
The Vanguard-class nuclear submarines are central to the United Kingdom’s continuous at-sea nuclear deterrent, operating covertly beneath the ocean’s surface. Each submarine is equipped with up to 16 Trident II D5 ballistic missiles, which have long-range precision strike capabilities. At any given time, at least one Vanguard-class submarine is on active patrol, ensuring an uninterrupted and stealthy nuclear deterrent presence worldwide. Commissioned in the 1990s, the Vanguard-class remains a vital component of the UK’s national defense strategy. Although these submarines are scheduled to be replaced by the next-generation Dreadnought-class within the next decade, they continue to serve as the backbone of Britain’s nuclear deterrent, maintaining a continuous and covert operational posture across global waters.
energynuclear-energysubmarine-technologydefense-technologymilitary-materialsnuclear-deterrentballistic-missilesUK firm achieves first commercial tritium breakthrough for fusion fuel
Astral Systems, a UK-based private fusion company, has achieved a significant milestone by becoming the first firm to successfully breed tritium—a crucial fuel for nuclear fusion—using its own operational fusion reactor. This breakthrough occurred during a 55-hour Deuterium-Deuterium (DD) fusion irradiation campaign in March, in collaboration with the University of Bristol. The teams produced and detected tritium in real-time from an experimental lithium breeder blanket within Astral’s multi-state fusion reactors, addressing a major challenge in sustainable fusion energy development: generating more fuel than consumed. Astral Systems’ reactor employs its proprietary Multi-State Fusion (MSF) technology, which integrates recent advances in stellar physics and a novel lattice confinement fusion (LCF) approach, originally discovered by NASA in 2020. This design achieves solid-state fuel densities vastly exceeding those in plasma and enables two simultaneous fusion reactions within a compact reactor core. The electron-screened environment reduces the energy needed to overcome particle repulsion, lowering fusion temperatures and improving efficiency. This innovation not only advances tritium breeding but also opens possibilities for applications such as medical isotope production, nuclear waste transmutation, and hybrid fusion-fission systems. The University of Bristol team, supported by UK research bodies, is now focused on optimizing the system to enhance tritium output, signaling a promising path toward scalable fusion fuel production.
energynuclear-fusiontritium-breedingfusion-fuelfusion-reactorsustainable-energyfusion-technologyUber Just Reinvented the Bus … Again
Uber has launched Route Share, a new shuttle service operating on fixed routes and schedules in seven cities, aiming to provide more affordable and predictable transportation during peak commuting hours. This initiative marks Uber’s latest attempt to "reinvent the bus," following earlier efforts by Uber, Lyft, Elon Musk, and others to introduce ride-sharing services resembling traditional public transit. Uber’s leadership acknowledges the concept is inspired by buses, with the goals of reducing consumer prices, easing congestion, and improving environmental outcomes. However, experts express skepticism about the program’s benefits for commuters, climate, and public transit systems. The Union of Concerned Scientists highlights that rideshare services currently produce significantly more emissions than the trips they replace, partly due to "deadheading"—drivers traveling without passengers. While pooled rides reduce this impact somewhat, the environmental advantage remains limited unless electric vehicles are used. Moreover, there are concerns about Uber’s lack of public accountability compared to traditional transit agencies, which serve all riders regardless of profitability and are subject to public oversight. This shift toward privatized transit services could undermine struggling public systems, especially in cities like Philadelphia and Dallas facing severe budget crises and service cuts. The broader context includes federal funding reductions for public transit, leaving many systems financially vulnerable post-pandemic. With a nationwide transit budget shortfall estimated at $6 billion, companies like Uber see an opportunity to fill gaps in public transportation. Despite Uber CEO Dara Khosrowshahi’s insistence that the company competes with personal car use rather than public transit, critics worry that such private shuttle services may exacerbate challenges for public transit and fail to deliver meaningful environmental improvements.
energytransportationride-sharingelectric-vehiclesurban-mobilityenvironmental-impactpublic-transitClimate Change Is Causing The Florida Real Estate Market To Tumble - CleanTechnica
The article discusses the growing impact of climate change on Florida's real estate market, highlighting how increasingly severe hurricanes and stricter building regulations are driving up costs and destabilizing property values. Following the 2021 collapse of the Champlain Towers South condominium, Florida implemented rigorous "Milestone Inspections" for aging coastal condos, requiring costly structural upgrades. These expenses, combined with the rising frequency and intensity of hurricanes fueled by warmer ocean temperatures, have significantly increased insurance premiums and property maintenance costs for homeowners and associations. Hurricanes Helene and Milton further exacerbated the situation in Lee County, displacing residents and causing extensive damage. Insurance companies have pulled back from the Florida market, forcing many homeowners to rely on the state-backed insurer of last resort, Citizens Property Insurance Corp., which has led to steep premium hikes. The combined financial pressures from insurance rate increases and mandatory building repairs have created a "climate cost burden," pricing many condo owners out of the market. Although new insurers have entered Florida, higher deductibles and ongoing climate-related risks, such as saltwater intrusion damaging building foundations, continue to complicate the real estate and insurance landscape in the state.
energyclimate-changehurricanesreal-estate-impactbuilding-safety-regulationsinsurancedisaster-recoveryComEd's New EV Ambassador Program - CleanTechnica
ComEd has launched a new EV Ambassador Program aimed at increasing education and awareness about electric vehicle (EV) adoption in northern Illinois. This community-driven initiative involves three local partner organizations—A Step Beyond NFP, Bronzeville Community Development Partnership, and Equiticity—who will engage residents and businesses through summer events, presentations, and EV demonstrations. The program seeks to help customers understand the benefits of switching to EVs, such as fuel cost savings and reduced environmental impact, while connecting them with resources like rebate programs, an EV dealership network, and an EV toolkit. The EV Ambassador Program is part of ComEd’s broader Beneficial Electrification (BE) Plan, which provides financial incentives and support for cleaner transportation. Originally launched in 2023, the BE Plan funding has been extended through 2028. The selected ambassador organizations focus on sustainability and serving historically underserved communities disproportionately affected by pollution. They emphasize overcoming barriers to EV adoption, particularly lack of awareness about economic and health benefits. Community members can interact with EV Ambassadors and experience EV technology firsthand at various events throughout the summer, with more events planned for the year.
energyelectric-vehiclesEV-adoptionclean-energybeneficial-electrificationcommunity-engagementsustainabilityOn Tesla, Irrational Support, & Irrational Hate - CleanTechnica
The article "On Tesla, Irrational Support, & Irrational Hate" from CleanTechnica presents two thoughtful perspectives on the polarized views surrounding Tesla. Larry Evans argues that Tesla has long enjoyed irrational support, leading to distorted perceptions where objective criticism is misinterpreted as hate. He highlights examples such as disproportionate state subsidies for solar manufacturing, exclusive contracts for Tesla chargers on state property, and Tesla’s high price-to-earnings ratio despite declining financial metrics. Evans contends that calls for Tesla to meet agreed-upon obligations or for a market correction are reasonable and not driven by irrational animosity. He suggests that the focus should shift toward other clean technology companies rather than continuing to idolize Tesla. The second perspective, from a user named Taycan, critiques Tesla’s recent management and product performance. They question Tesla’s lack of successful product launches in recent years and criticize CEO Elon Musk’s controversial actions and mismanagement, which they believe have damaged the company’s reputation and operations. Taycan notes that while Tesla’s early efforts helped establish the battery electric vehicle (BEV) sector, the company now faces challenges as the industry matures and competition intensifies. This view reflects growing skepticism even among Tesla’s former supporters, emphasizing the need for Tesla to prove its leadership through sustained innovation and sound management. Overall, the article underscores the complexity of public sentiment toward Tesla, balancing recognition of its early contributions to clean technology with calls for more objective evaluation of its current performance and governance. It encourages moving beyond polarized views to foster a broader focus on the evolving clean tech landscape.
energyclean-technologyTeslasolar-manufacturingelectric-vehiclesstate-subsidiescharging-infrastructureFirefly Likely to Come to UK in October - CleanTechnica
NIO, the Chinese electric vehicle (EV) maker, is facing financial challenges despite growing sales in a highly competitive domestic market. To sustain growth, NIO launched an affordable small-car brand called Firefly, which has been well-received for its attractive design and advanced technology. The Firefly model is compact yet practical, featuring a 141 hp motor, a 260-mile (418 km) range under the CLTC standard, a class-leading 4.7-meter turning radius, and automated parking capabilities. It also offers a front trunk (frunk) with 92 liters of storage, enhancing its utility despite its small size. Looking to expand internationally, NIO is reportedly planning to introduce the Firefly brand to the UK market as early as October 2025. The UK is one of the largest EV markets globally and has a strong demand for small electric cars, positioning Firefly to compete against models like the Volkswagen ID.2, Renault 5, Hyundai Ioniq 3, and Kia EV3. While the Firefly’s starting price in China is approximately £12,350 ($16,700), the UK price remains unknown and will likely be higher due to shipping and import costs. Early sales in China showed promise, with 3,680 deliveries in its first full month, indicating potential for success abroad if the brand resonates with UK consumers.
energyelectric-vehiclesEV-marketNIOFireflyautomotive-technologyclean-energyEVs Take 94.9% Share In Norway - Renault 5 First Customer Deliveries - CleanTechnica
In May 2024, plugin electric vehicles (EVs) dominated the Norwegian auto market with a combined market share of 94.9%, up significantly from 82.3% a year earlier. Battery electric vehicles (BEVs) alone accounted for 93.9% of sales, while plugin hybrids (PHEVs) made up just 1.1%. Overall vehicle sales increased 39% year-on-year to 14,260 units. The Tesla Model Y continued its strong performance, securing the top spot for the third consecutive month with 2,344 units sold, representing over 16% of the passenger auto market. Other notable models included the Toyota BZ4X, Volkswagen ID. Buzz, MG4, BYD Sealion, and the Volvo EX90, which entered the top 20 for the first time. The market dynamics in early 2024 have been somewhat erratic due to factors such as manufacturers clearing older non-plugin stock ahead of stricter EU safety regulations and tax changes on non-BEVs, especially PHEVs. This has led to fluctuations in sales patterns, but the market is expected to stabilize with BEVs maintaining a dominant share between 94% and 98%. Newcomers like the Renault 5 have started customer deliveries and showed promising initial sales (59 units), hinting at potential growth. Other new entrants such as the Opel Frontera and Mazda 6e have also appeared, though some models like the Citroen e-C3 and Hyundai Ioniq 5 showed signs of sales plateauing or temporary dips. Overall, Norway’s EV market continues to grow robustly, with BEVs firmly established as the preferred choice among consumers.
energyelectric-vehiclesbattery-electric-vehiclesNorway-EV-marketTesla-Model-Yclean-transportationautomotive-industry-trendsMeet the Finalists: VivaTech’s 5 Most Visionary Startups of 2025
VivaTech 2025 has announced the five finalists for its inaugural Innovation of the Year award, selected from an initial pool of 30 visionary startups addressing global challenges with advanced, scalable technologies. The finalists represent diverse sectors including physics simulation, medical imaging, renewable energy, cancer diagnostics, and data center efficiency. They are BeyondMath, which offers a generative physics platform enabling engineers to run simulations 1000 times faster; Chipiron, developing an affordable, ultra-low magnetic field MRI for widespread early screening; Enerdrape, providing non-invasive geothermal panels for urban heating and cooling; Hua Tech International, creating an automated microfluidic platform for precise cancer cell analysis; and Lumisync, delivering a photonic oscillator to drastically reduce data center latency and energy use. These startups will present their pitches live on June 11th at VivaTech 2025, followed by a Q&A with expert judges from TechCrunch, 25madison, Daphni, and NVIDIA. The winner, announced on June 12th, will receive a free Startup Corner at VivaTech 2026 and entry into the TechCrunch Startup Battlefield 200. The awards ceremony will also honor winners of four other categories: the Female Founder Challenge, Africatech Awards (focusing on GreenTech, HealthTech, and E-commerce/FinTech), the Next Startupper Challenge for student entrepreneurs, and the new Tech For Change Award recognizing startups with positive social impact. VivaTech’s Innovation of the Year aims to spotlight startups with exceptional creativity and transformative potential across industries.
energyrenewable-energygeothermal-technologyAI-simulationphotonic-oscillatorsemiconductor-biochipmedical-imagingScalable method efficiently squeezes hydrogen from seawater
Researchers have developed a novel, scalable method to efficiently produce hydrogen directly from seawater, overcoming longstanding challenges such as corrosion and performance degradation caused by chloride ions. The key innovation is a custom-designed, multi-layered electrode featuring carbonate (CO₃²⁻) Lewis base sites anchored on cobalt layered double hydroxides (Co LDH) embedded within a nickel borate (NiBOx) nanostructure supported by a Ni(OH)₂/NF microarray. This structure creates a protective microenvironment that resists chloride-induced corrosion by forming a metaborate film, preventing metal dissolution and non-conductive oxide formation, thereby enhancing durability and efficiency in saline conditions. The electrode achieves an industrially relevant current density of 1.0 A cm⁻² at 1.65 V under standard conditions without requiring desalination or chemical additives, marking a significant advance toward sustainable, large-scale green hydrogen production. The carbonate-functionalized Co sites facilitate continuous water splitting and localized acidification, which improves oxygen evolution reaction kinetics and protects against chloride attack. This technology holds particular promise for arid coastal regions like the UAE, where abundant seawater and sunlight but limited freshwater resources could enable solar-powered hydrogen farms, potentially revolutionizing hydrogen production by reducing reliance on freshwater and energy-intensive desalination processes.
energyhydrogen-productionseawater-electrolysisgreen-hydrogencorrosion-resistancenanostructured-electrodesrenewable-energyEurope tames ‘elephant flows’ in 1.2 Tbit/s supercomputer trial
Europe achieved a record-breaking 1.2 terabit-per-second (Tbit/s) data transfer across 2,175 miles (3,500 kilometers) in a supercomputing trial involving CSC (IT Center for Science), SURF, and Nokia. The test demonstrated a quantum-safe, high-capacity fibre-optic connection between Amsterdam, Netherlands, and Kajaani, Finland, transferring both real research and synthetic data directly disk-to-disk. The data traversed five production research and education networks, including NORDUnet, Sunet, SIKT, and Funet, leveraging Nokia’s IP/MPLS routing and quantum-safe optical technology. Nokia’s Flexible Ethernet (FlexE) was key to managing “elephant flows,” or very large continuous data streams, proving the feasibility of ultra-fast, long-distance data transport critical for AI and high-performance computing (HPC). This milestone highlights the importance of resilient, scalable, and secure cross-border connectivity to support the exponential growth of research data, especially for AI model training and supercomputing workloads. The trial supports Europe’s ambitions for supercomputing infrastructure, such as the LUMI supercomputer in Kajaani and AI projects like GPT-nl, enabling seamless workflows across distributed data centers. The success of this multi-domain, high-throughput network test underscores the value of strategic partnerships and advanced digital backbones in driving scientific progress and preparing for future AI and HPC demands. Overall, the trial sets a new benchmark for operational long-distance data networks, providing critical insights into data transport and storage infrastructure. Stakeholders emphasized that despite geographical distances, reliable and scalable data connections are achievable and essential for Europe’s research ecosystem. Nokia and its partners are committed to continuing support for global research and education networks, ensuring they can scale confidently to meet the next generation of discovery and innovation.
energysupercomputingAIdata-transferoptical-networksquantum-safe-technologyhigh-capacity-connectivityIndia's Coal & Gas Decline Signals Accelerating Renewable Energy Transition - CleanTechnica
The article highlights a significant shift in India’s energy landscape, marked by a steep decline in coal usage as of May 2025—the largest year-over-year drop since the COVID-19 pandemic. This decline is driven by economic slowdowns, rapid expansion of renewables, and increasingly cost-competitive solar and wind projects, signaling a potential tipping point toward decarbonization. Despite coal’s entrenched role in powering India’s industrial sectors and accounting for nearly half of the country’s primary energy input in 2023, its inefficiencies—where about two-thirds of coal’s energy content is lost as waste heat—underscore the urgency for a transition to cleaner, more efficient energy sources. Renewables, while growing, still made up less than a quarter of electricity generation in 2023, reflecting the substantial scaling challenges ahead. Looking toward 2050, the article envisions a fully electrified Indian economy predominantly powered by renewables such as wind, solar, and hydro, with nuclear energy maintained at current levels. This future energy system would leverage the efficiency gains of electrification, particularly through widespread adoption of electric vehicles and heat pumps, which significantly reduce energy demand in transport, residential, and commercial sectors. The strategic use of ambient environmental heat via heat pumps and the integration of geothermal energy could further reduce electricity needs, transforming India’s energy consumption into a highly efficient and sustainable model. This transition offers not only environmental benefits but also economic resilience by addressing inefficiencies and reducing reliance on fossil fuels.
energyrenewable-energycoal-declinesolar-powerwind-energydecarbonizationIndia-energy-transitionGerman Car Industry Demands the EU Guts Its CO2 Law, Despite Climate Consequences - CleanTechnica
The German car industry, represented by the VDA, is pushing the European Union to weaken its 2035 climate target for vehicle emissions, seeking exemptions for plug-in hybrids and incentives for low-carbon fuels. This comes after the industry previously opposed the 2025 EU target despite rising electric vehicle (EV) sales in Germany. If the EU accedes to these demands, carbon emissions from cars in Europe could increase by 0.5 to 1.4 gigatons, up to 31% more than current targets, according to Transport & Environment (T&E) analysis. T&E criticizes the industry’s proposal as a strategic move to undermine the EU’s climate goals, warning it would reduce battery electric vehicle (BEV) sales to between 44% and 69% by 2035, far below the current 100% target. This rollback would damage market certainty and investor confidence, particularly in battery and charging infrastructure, hindering Europe’s efforts to build resilience in the EV sector. T&E emphasizes that the global automotive market is moving toward electrification regardless, and weakening the EU’s standards risks leaving its auto industry behind. The EU Commission is currently under pressure to review the 2035 law earlier than planned, following a delay in the 2025 target.
energyelectric-vehiclesCO2-emissionsEU-climate-policybattery-technologyautomotive-industryrenewable-energyUnlocking e-SAF’s Potential for the EU Competitiveness & Energy Independence - CleanTechnica
The article highlights the European Union’s Sustainable Transport Investment Plan (STIP) as a critical opportunity to unlock the potential of e-SAF (electro-sustainable aviation fuel), which is considered the greenest and most scalable sustainable aviation fuel. E-SAF, or e-kerosene, has the capacity to reduce aviation CO₂ emissions by over 90%, making it a vital solution for long-term decarbonization of the aviation sector. Despite supportive regulatory frameworks like the Fit for 55 package and ReFuelEU Aviation, e-SAF projects in the EU have struggled to reach final investment decisions due to high costs, lack of long-term purchase agreements, and market uncertainties. To address these challenges, the article proposes that the STIP should prioritize e-SAF by implementing mechanisms such as a European Hydrogen Clearing House (EHCH). This clearing house would facilitate double-sided auctions to match fuel producers with buyers, ensuring price stability and aggregated demand. Such a system would de-risk investments in e-SAF production through long-term contracts and contracts for differences, fostering scale-up while aligning with the EU’s goals for industrial competitiveness, energy independence, and job creation. Ultimately, prioritizing e-SAF under the STIP is framed not only as an environmental necessity but also as a strategic move to position Europe as a global leader in sustainable aviation fuels and clean energy innovation.
energysustainable-aviation-fuele-SAFEU-energy-independenceclean-energydecarbonizationhydrogen-economyQuaise "Proof Of Concept" Demo Goes Live In Texas - CleanTechnica
Quaise, an MIT spinoff, is pioneering a novel geothermal drilling technology that uses high-powered microwaves generated by gyrotrons to bore through hard rock such as basalt and granite. This approach aims to reach superhot zones located up to 12,000 feet (about 2 to 4 kilometers) beneath the Earth's surface, where temperatures exceed 374º C (700º F). At these depths, water can be converted into supercritical steam, which is highly efficient for generating electricity. Quaise envisions tapping into this vast geothermal heat as a nearly limitless, clean energy source capable of meeting global electricity demands for millions of years. The concept originated from Paul Woskov’s fusion research at MIT, where he realized that gyrotrons—powerful microwave sources used to heat plasma—could be repurposed to vaporize rock and create deep boreholes. In 2018, Carlos Araque and Matt Houde joined Woskov to found Quaise, combining expertise from MIT and the oil and gas industry. Recently, Quaise completed its first proof-of-concept demonstration near Houston, Texas, where their microwave drilling technology successfully penetrated 10 feet into granite within an existing oil well. Although this is an early milestone far from the ultimate goal of drilling miles deep, the company emphasizes its mission to become a geothermal developer providing abundant, reliable, and affordable clean energy worldwide, rather than merely selling drilling equipment.
energygeothermal-energyclean-energydrilling-technologymicrowavesfusion-researchsustainable-powerLithium battery waste gets AI-powered fix from Hong Kong startup
Hong Kong startup Achelous Pure Metals is addressing the growing global e-waste crisis, particularly lithium-ion battery waste, with an AI-powered, portable recycling system designed for urban centers. The company has developed a robot-assisted pilot line capable of sorting, shredding, and filtering materials from non-electric vehicle lithium batteries. Their process includes vacuum and heat treatments to safely extract hazardous substances and uses nanoparticle-based separation to isolate critical metals like lithium, cobalt, and nickel from the "black mass" residue. Achelous aims to scale and deploy this eco-friendly recycling technology starting in Hong Kong and expanding across Southeast Asia. Despite deploying technology at a client facility in Jiangsu province capable of processing up to 10,000 tonnes of battery waste annually, the startup faces challenges due to oversupply and falling prices of recycled lithium products. Lithium carbonate prices have dropped nearly 90% from late 2022 to mid-2024 amid a surge in China’s recycling capacity and black mass competition. In response, Achelous is pivoting by expanding its Hong Kong operations and helping partners across Southeast Asia establish micro-factories to produce black mass for export to China. The company is also exploring recycling opportunities for lithium batteries from security transceivers and working with local firms in Malaysia and Singapore to meet future recycled content regulations and compliance tracking. This initiative comes amid a mounting global e-waste problem, with 62 million tonnes generated in 2022 and projections reaching 82 million tonnes by 2030. Metals in e-waste are valued at $91 billion, yet only 22% was properly recycled in 2022. Governments worldwide, including the EU, are tightening regulations to increase lithium recovery rates, underscoring the urgent need for innovative recycling solutions like those developed by Achelous Pure Metals.
energylithium-batteriesbattery-recyclingAI-powered-recyclinge-waste-managementmaterials-recoverysustainable-technologyHating on Tesla vs. Objective Realism - CleanTechnica
The article from CleanTechnica reflects on Tesla's evolving trajectory over the past 13 years, highlighting a shift from its early days of visionary growth to recent challenges. Initially, Tesla experienced rapid expansion fueled by strong consumer demand for affordable, long-range electric vehicles like the Model 3 and Model Y, validating early optimistic coverage despite widespread skepticism. However, in recent years, Tesla's sales growth has stalled and even declined, with increasing competition eroding its market share. The article notes that Tesla fans often rationalize these setbacks with hopes for future breakthroughs, but the current reality suggests a departure from Tesla’s original growth story. Additionally, the article discusses Elon Musk’s increasingly controversial political involvement, which has alienated various groups, including both critics and some supporters. Musk’s public behavior and focus have shifted significantly compared to a decade ago, raising questions about his leadership and the company’s direction. While some remain hopeful about Tesla’s potential in emerging sectors like robotaxis, AI, and robotics, these represent a significant departure from Tesla’s initial business plan and require a leap of faith. The article emphasizes the importance of objective realism, acknowledging that Tesla and Musk have changed, and that recognizing current challenges is not hatred but a necessary assessment of the company’s status.
energyelectric-vehiclesTeslabattery-technologyrenewable-energyautomotive-innovationclean-technologyUS firm plans 10 GW power from small reactors at retired nuclear site
Florida-based Holtec International, in partnership with Hyundai Engineering & Construction, plans to deploy advanced small modular reactors (SMRs) at the retired Palisades nuclear plant site in Michigan by 2030. The project, part of Holtec’s “Mission 2030” program, aims to build America’s first SMR-300 units—each a 300 MW advanced, passively safe, pressurized light water reactor—co-located with the existing 800 MW Palisades plant, which is currently being restarted after its 2022 shutdown. Holtec intends to build a 10-gigawatt fleet of SMR-300s across North America during the 2030s, leveraging the cost advantages of deploying SMRs at existing nuclear sites. Holtec is also exploring additional SMR deployments, including up to four units at the Oyster Creek site in New Jersey, where a 625 MW boiling water reactor is slated for decommissioning by 2029. The company sees significant growth potential for SMRs in the Mountain West region, particularly in Utah and Wyoming, supported by ongoing testing at Idaho National Laboratory and recent pro-nuclear legislation in Utah. Holtec’s SMR-300 design emphasizes passive safety features, such as gravity-driven safety systems, earning it a “walk-away safe” designation, and positions the company to compete globally against state-backed reactor vendors by offering comprehensive lifecycle services from construction to decommissioning. The Palisades SMR-300 project is intended to serve as a global benchmark for next-generation nuclear technology deployment, advancing U.S. leadership in clean energy innovation and unlocking worldwide opportunities for SMR adoption. Holtec highlights the project’s role in providing clean, reliable energy capable of powering hundreds of thousands of homes while maintaining high safety and operational standards.
energysmall-modular-reactorsnuclear-powerSMR-300clean-energypower-plantHoltec-InternationalUltra-light printed solar charges Coldplay batteries at Stanford
Coldplay’s recent concert at Stanford Stadium showcased a pioneering use of ultra-light, flexible printed solar panels developed by Australian start-up Kardinia Energy. Covering 5,920 ft², these paper-thin organic photovoltaic films recharged the batteries powering the band’s smaller stage and backstage operations. The technology, created by adapting a commercial wine-label printer to coat recyclable plastic sheets with carbon-based semiconducting polymers, results in a lightweight (300 g/m²), rollable solar film that can be installed quickly by a small crew. This deployment represents one of the largest mobile solar arrays ever used at a live event and serves as a real-world test of the panels’ energy output, durability, and mobility under the demanding conditions of a stadium tour. Kardinia’s printed solar panels offer advantages over traditional silicon photovoltaics, including ultra-low weight, rapid installation, and full recyclability, making them suitable for surfaces and applications where conventional panels are impractical—such as lightweight roofs, curved façades, temporary structures, and disaster-relief tents. Although these organic panels have lower efficiency per square meter and potentially shorter lifespans than silicon, their low cost (up to ten times cheaper) and ease of deployment open new markets. Coldplay plans to continue using the technology throughout 2025, helping to raise awareness while Kardinia refines the product for broader off-grid uses like warehouse rooftops and refugee camps. The successful Stanford trial points toward a future where portable, printed solar farms support not only entertainment events but also remote exploration and emergency response.
energysolar-energyprinted-solar-panelsorganic-photovoltaicsrenewable-energyflexible-solar-technologyclean-energyThe Plan to Send Plant-Filled ‘Gardens’ Into Orbit
The article discusses the innovative Space Garden project, a concept for sending plant-filled "gardens" into low Earth orbit within the next five to seven years. Developed by the Aurelia Institute and a London-based design firm, the Space Garden aims to transform life in space by incorporating greenery into orbital habitats, making them more livable and psychologically beneficial for space commuters. The design features a central core of conical terraria surrounded by multiple arms ending in discs, intended to house a variety of plants, including culturally and aesthetically significant "hero" species like fig or pomegranate trees, moving beyond the typical lettuce and watercress grown in space so far. The article highlights the history and challenges of space gardening, noting that astronauts have grown crops such as onions, wheat, and tomatoes aboard space stations, and that seeds have even been tested on the lunar surface. Research led by Mike Dixon at the University of Guelph has sent millions of seeds into space, with many surviving exposure to cosmic radiation and extreme conditions, especially when shielded. Plants have shown surprising resilience to reduced pressure, oxygen levels, and temperature fluctuations, often outperforming humans in tolerating space environments. This resilience suggests plants will not be the limiting factor in space exploration, although the article cuts off before detailing the remaining challenges faced by space gardeners.
energyspace-gardeningspace-agricultureorbital-horticulturespace-architectureplant-growth-in-spacespace-exploration-materialsOntario budget sees some wins for the clean economy but misses opportunities for long-term affordability and economic security - Clean Energy Canada
The Ontario 2025 budget includes strategic investments aimed at preparing the province’s economy for the future, with some notable wins for the clean economy. Clean Energy Canada welcomed the $92 million boost to the ChargeON program, which supports the expansion of electric vehicle (EV) charging infrastructure, having already facilitated over 1,300 charge points. This investment is seen as crucial for promoting EV adoption, reducing reliance on imported gasoline, and enhancing energy security by using locally generated electricity. However, the organization urged the government to extend support for EV chargers in multi-unit residential buildings to ensure equitable access to convenient home charging for all Ontarians. Additionally, the budget allocates $500 million to a critical minerals processing fund, aiming to refine minerals mined in Ontario locally. This move leverages Canada’s rich mineral resources to strengthen the EV battery supply chain, attract investment, and increase competitiveness on the global stage, particularly against countries like China. The budget also includes $50 million for the Ontario Together Trade Fund to boost interprovincial trade infrastructure, supporting the vision of a unified Canadian economy. Despite these positive steps, Clean Energy Canada expressed concern over proposed changes in Bill 17 that could undermine municipal authority on Green Development Standards, potentially compromising energy efficiency and long-term affordability in housing development. Overall, while the budget takes important steps toward economic growth, supply chain resilience, and clean energy leadership, Clean Energy Canada emphasizes the need for more comprehensive support for clean growth sectors and stronger provincial standards to ensure sustainable, affordable development. Thoughtful implementation of these initiatives is deemed essential to protect households, support workers, and secure Ontario’s economic future.
energyclean-energyelectric-vehiclesEV-charging-infrastructurecritical-mineralsbattery-supply-chainenergy-efficiencyBuilding economic growth and improving affordability should be realized in a way that stands the test of time - Clean Energy Canada
The article from Clean Energy Canada emphasizes that Canada's new government, as reflected in the recent Throne Speech, is embracing a vision centered on transformative change rather than maintaining the status quo. Key to this vision is rethinking trade relationships, investing in emerging industries, and integrating affordability and sustainability into economic growth strategies from the outset. The government aims to implement an industrial strategy that simultaneously enhances global competitiveness and addresses climate change, viewing these goals as complementary rather than separate. The piece highlights that transitioning to clean energy and using low-carbon construction materials can reduce household energy costs over time and lower emissions, making homes more affordable to live in monthly. Canada’s extensive trade agreements with 60% of the global economy position it well to diversify away from reliance on U.S. markets, especially as many of its major trade partners have net-zero commitments and carbon pricing policies. The article underscores the significant opportunities in Canada’s critical minerals, clean technologies, and low-carbon industrial products sectors. It calls on the federal government to invest domestically by adopting “Buy Clean” policies that support Canadian industries and make clean technologies more accessible and affordable for Canadians, reinforcing that now is the time for innovative, forward-thinking policies rather than maintaining existing approaches.
energyclean-energylow-carbon-materialssustainabilityclimate-changeindustrial-strategynet-zeroBuilding clean does not need to break the bank - Clean Energy Canada
The article from Clean Energy Canada emphasizes that addressing Canada’s housing shortage and climate goals can be achieved simultaneously without significant cost increases. While much attention is given to reducing emissions from heating and powering homes, the emissions embedded in construction materials like concrete, steel, drywall, and insulation are often overlooked. These materials contribute substantial industrial emissions, with a single home’s construction potentially locking in emissions equivalent to decades of car travel. Given the scale of housing needed by 2030, ignoring these emissions could undermine national climate targets. Fortunately, cleaner, low-emission alternatives for key construction materials are already available at little to no additional cost. A report by Clean Energy Canada highlights that options such as low-emission drywall and insulation can reduce emissions by up to 98% without price premiums, and cleaner steel and concrete alternatives often come at negligible extra cost. Even when slight cost increases occur, they are minimal relative to overall project budgets. Prioritizing these materials supports Canadian producers, who benefit from a cleaner electricity grid and innovation, and aligns with government strategies like the “Buy Clean” approach, which mandates emissions reductions in publicly funded projects. Additionally, more efficient building designs that reduce material use can cut emissions by up to 40%, offering further savings in cost and carbon footprint. The article concludes that building affordable, climate-friendly housing with Canadian materials is both feasible and economically sensible.
energyclean-energylow-emissions-materialssustainable-constructiongreen-buildingclimate-goalsCanadian-materialsThe Bomb That Will Hit The US Solar Industry From The "Big Beautiful Bill" - CleanTechnica
The article from CleanTechnica critiques a Republican budget bill, labeling it a "Big Ugly Bill" that threatens the clean technology sector, particularly the solar industry. The author argues that the bill aims to undermine the progress made under President Biden by targeting electric vehicles, wind, and solar energy initiatives. The Solar Energy Industries Association (SEIA) warns that the legislation could lead to the loss of over 100,000 jobs in the solar and storage sectors across the U.S., with significant job losses projected in Republican-led states like Texas and Florida. The bill could also result in the closure of 331 factories and a loss of $286 billion in local investments. The article emphasizes the detrimental impact of the proposed legislation on American families and the economy, suggesting that it contradicts the notion of "Making America Great Again." It highlights the historical support of Republican politicians for fossil fuels over clean energy, indicating a lack of concern for the adverse effects on their constituents. While there is a slim possibility that some Republican lawmakers may advocate for pro-solar policies, the author expresses skepticism about any positive outcomes, suggesting that the situation is likely to worsen for the clean technology industry.
energysolar-industryclean-technologyjob-lossrenewable-energylegislationfossil-fuelsAMD acqui-hires the employees behind Untether AI
energyAIsemiconductoracquisitionefficiencyroboticstechnologyDutch firm eyes nuclear power propulsion for greener cargo fleet
energynuclear-propulsioncarbon-emissionssmall-modular-reactorsoffshore-vesselssustainable-shippingdecarbonizationNew smart robot fleet can take over urban policing, reforestation
robotIoTenergyreforestationautonomous-systemsenvironmental-restorationpublic-safetyOffshore Wind Power's Big Benefits - CleanTechnica
energyoffshore-windrenewable-energyelectricity-marketgrid-reliabilityclean-energyenergy-costsNREL Announces 2025 Executive Energy Leadership Cohort - CleanTechnica
energyrenewable-energyenergy-leadershipenergy-technologyNRELclean-energyenergy-innovationWhat Benefits Will Tesla Now Get with Trump–Musk Fallout? - CleanTechnica
energyelectric-vehiclesTeslaElon-Muskclean-energygovernment-policyFord F-150 is Top Selling Electric Truck in USA — in May and All Time - CleanTechnica
electric-vehiclesFord-F-150-Lightningenergyclean-technologyelectric-truckssustainable-transportationautomotive-innovationScientists build €8 underwater data hubs from old smartphones
robotIoTenergymaterialsdata-centerssustainabilitymarine-technologyBYD Is Suing 37 Influencers - CleanTechnica
energyelectric-vehiclesBYDclean-technologyrenewable-energyautomotive-sectorlegal-actionNew Ontario Building Act means province must step up to make new homes energy efficient - Clean Energy Canada
energyEV-readinessclean-construction-materialsOntario-building-codeenergy-efficiencyelectric-vehiclessustainable-housingEVs At 63.2% Share In Sweden – Lynk & Co. 02 Debuts - CleanTechnica
energyelectric-vehiclesEV-salesSwedenbattery-electric-vehiclesplugin-hybridsautomotive-industryAnother Electric Vehicle Benefit: No Motor Oil Leaks - CleanTechnica
energyelectric-vehiclespollutionmotor-oilenvironmental-impacttransmission-fluidclean-technologyTorque, Trails, & Tech: Bakcou’s Puma X22 & X24 Lead The E-Moto Pack - CleanTechnica
energyelectric-motorcycleslithium-ion-batterye-motoclean-technologysustainable-transportpowertrainLatest AAA Survey Casts A Shadow Over The EV Revolution - CleanTechnica
energyelectric-vehiclesEV-revolutionconsumer-behaviorbattery-costsautomotive-industryclean-energyGermany's 36% efficient micro-CPV boosts solar power while cutting costs
energysolar-powermicro-CPVrenewable-energyphotovoltaic-technologyefficiencysustainable-energySpinning sculptures turn River Neath into a living, singing artwork
energyenvironmental-storytellingkinetic-energyfreshwater-habitatssustainable-artanalog-animationwildlife-conservationThe New Electric Bulldozer That Could Drive on the Moon
robotIoTenergyelectric-vehicleslunar-technologyremote-controlheavy-machineryCorruption clouds California's solar boom, study warns of deep abuses
energysolar-energyclean-energyCaliforniacorruptionsustainabilityrenewable-energyTop Selling Electric Vehicle Brands Worldwide in April — Hot Geely Beats Tesla - CleanTechnica
energyelectric-vehiclesEV-salesautomotive-industryGeelyTeslaBYDEU’s New Carbon Tax (ETS2) a €300bn Opportunity to Help Transition European Citizens Away from Fossil Fuels - CleanTechnica
energycarbon-taxgreen-infrastructureemissions-tradingelectric-mobilityfossil-fuelsclimate-policyUkraine's Reconstruction Will Be Green, Transport Must Play Its Part - CleanTechnica
energysustainable-mobilitygreen-reconstructiontransport-infrastructureenergy-efficiencyUkrainerailway-lawCan von der Leyen Save Europe's Car Industry from 'the Slow Agony of Decline'? - CleanTechnica
energyelectric-vehiclesbatteriesEU-Commissiondecarbonisationautomotive-industryproduction-aidWho and How Can Help Indonesia Clean Up Its Minerals Act - CleanTechnica
energymineralssustainabilitysupply-chainclean-technologyIndonesiaelectric-vehiclesSeabed sensors to monitor CO2 storage at UK offshore carbon capture site
energycarbon-captureenvironmental-monitoringoffshore-technologysubsea-sensorsnet-zeroCO2-storageHidden Super-Emitters: The Climate Imperative Of Addressing Abandoned Fossil Fuel Infrastructure - CleanTechnica
energyclimate-changemethane-emissionsfossil-fuelsenvironmental-impactemissions-reductionregulatory-frameworksBYD Plans Megawatt Charging Network For Europe - CleanTechnica
energyelectric-vehiclescharging-networkBYDmegawatt-chargingbattery-technologyEV-infrastructureHow We Took On Aurora & Solo — And Built a Better, Faster, & Cheaper Solar Proposal Tool - CleanTechnica
energysolarproposal-toolaffordabilityspeedintegrationtechnologyWorld's 1st residential 'Microgrid-in-a-Box' to reduce 60% energy cost
energymicrogridrenewable-energyenergy-managementV2Genergy-cost-reductionsustainable-energyUS firm's solid electrolytes promise 50% energy boost for EV batteries
energysolid-state-batterieselectrolyteselectric-vehiclesbattery-materialshigh-energy-densitylithium-ion-batteriesElon Musk’s introduction to politics
energyTeslaclean-energyelectric-vehiclesgovernment-policysolar-energyElon-MuskHow ‘Ice Battery’ powers 4,000+ US buildings, cuts cooling energy use by 40%
energycoolingIce-Batteryenergy-savingspower-demandrefrigerationenergy-storageItaly's largest airport uses recycled EV batteries for power
energyrecycled-batteriesrenewable-energyenergy-storagesustainabilityelectric-vehiclesairport-innovationArcher’s electric aircraft takes off in first crewed runway flight
energyelectric-aircrafteVTOLaviation-technologyflight-testingsustainable-transportationelectric-vehiclesWorld’s first EV motor temperature sensor cuts down rare earth use
energyelectric-vehiclestemperature-sensorrare-earth-elementsmotor-performancesustainabilitye-MobilityWhale Dynamic partners with Noodoe to create self-driving delivery ecosystem - The Robot Report
robotIoTenergyautonomous-vehicleselectric-vehiclesdelivery-ecosystemAI-powered-chargingElectric HyBrid Passenger Plane In Development: The ES-30 - CleanTechnica
energyhybrid-electricaviationdecarbonizationelectric-aircraftbattery-technologyclimate-changeUS shows world-first quantum communication in live nuclear reactor
energyquantum-communicationnuclear-reactorcybersecuritydigital-transformationquantum-encryptionclean-energyGoogle bets big on TAE’s cost-effective nuclear fusion reactor
energynuclear-fusionclean-powerTAE-TechnologiesGoogleAIplasma-technologyFortescue Determined to Decarbonise International Shipping - CleanTechnica
energydecarbonisationgreen-hydrogenammonia-fuelshipping-emissionsrenewable-energymaritime-technologyDynamic Pricing Beats Time-of-Use Pricing — EV Charging Pilot - CleanTechnica
energyelectric-vehiclesEV-chargingdynamic-pricingclean-energygrid-stabilityrenewable-energyNREL & Crysalis Biosciences Collaborate To Scale Up Domestic Biomanufacturing Technologies - CleanTechnica
energybiomanufacturingbiofuelsbiomassrenewable-energychemicalsmaterialsSilicon Valley VC Approach Not The Best For Cleantech Investment, JPMorgan Says - CleanTechnica
energycleantechinvestmentclimatecapitalsustainabilityrenewable-energyMeta strikes 20-year nuclear power deal to fuel AI and save Illinois reactor
energynuclear-powerclean-energyAIdata-centerselectricity-demandrenewable-energyScalable lithium sulfide tech sets stage for solid-state battery boom
energymaterialssolid-state-batterieslithium-sulfidebattery-technologyproduction-processenergy-efficiencyWorld’s strongest stellarator hits 43-second fusion plasma milestone
energyfusionplasmaWendelstein-7-Xclean-energyhydrogenstellaratorEye-opening device: Self-powered AI synapse mimics human vision, achieves 82% accuracy
energyAIoptoelectronicssolar-cellsvisual-recognitionlow-power-systemsautonomous-vehiclesGoogle places another fusion power bet on TAE Technologies
energyfusion-powerTAE-Technologiesmachine-learningplasma-technologyinvestment-in-energyrenewable-energyPreliminary Data Shows Tesla Sales In Europe Continued To Fall In May - CleanTechnica
energyelectric-vehiclesTeslasales-dataNorwayModel-YEV-marketBeyond the Hydrogen Mirage: A Candid Conversation with Joe Romm - CleanTechnica
energyhydrogencarbon-capturesustainabilityclimate-solutionsmethaneclean-technologyMeta buys a nuclear power plant (more or less)
energynuclear-powercarbon-accountingclimate-impactdata-centersrenewable-energytech-companiesEngineers build blood-inspired battery to run robots more efficiently
robotenergybattery-technologyliquid-energy-storageelectrochemical-systemsrobotics-innovationoxygen-delivery-systemUK firm makes world’s highest energy density EV battery for hypercars
energyelectric-vehiclesbattery-technologyhypercarspower-densityRML-Groupautomotive-innovationNew quantum battery design promises nanoscale energy storage
energyquantum-batteryenergy-storagetopological-propertiesfast-chargingsustainable-energymicro-energy-devicesUS to shrink nuclear waste with compact particle accelerator tech
energynuclear-wasteparticle-acceleratorsuperconducting-materialswaste-transmutationArgonne-National-LaboratoryFermilabBe.EV Will Install Over 200 Ultra-Rapid Charging Bays In The UK - CleanTechnica
energyEV-chargingultra-rapid-chargerselectric-vehiclessustainable-energycharging-infrastructureBe.EV32-ton monster electric dozer packs 750 hp, charges 80% in 50 mins
robotIoTenergyelectric-vehiclesconstruction-technologyautonomous-machinerybattery-technologyNuclear electric propulsion may reduce transit times to outer planets
energynuclear-propulsiondeep-space-explorationpower-systemsfission-technologyspace-travelreliabilityEVs Take 22.3% Share In France - BYD Dolphin Surf Arrives In Showrooms - CleanTechnica
energyelectric-vehiclesBEVhybrid-vehiclesautomotive-marketFrancesustainable-transportationWorld's first net-zero energy mosque breaks ground in Abu Dhabi
energysolar-powersustainable-architecturenet-zero-energypassive-coolingeco-friendly-designrammed-earth-wallsAn early Joby Aviation backer might soon be its biggest distributor in Saudi Arabia
energyelectric-aircrafteVTOLdistribution-agreementJoby-AviationSaudi-Arabiaaviation-technologyUS liquid lead project to cut nuclear waste by 28 times in 30 years
energynuclear-wastetransmutationradioactive-materialsfission-technologyArgonne-National-LaboratoryDOEToyota’s liquid hydrogen car conquers Fuji 24-hr race with 468 laps
energyhydrogenfuel-efficiencyautomotive-technologyracing-innovationliquid-hydrogenToyota-Gazoo-RacingBYD's Commercial Vehicle Sales Up 531% in May — CHARTS - CleanTechnica
energyelectric-vehiclescommercial-vehiclesBYDsales-growthclean-technologytransportationNIO Highlights from May - CleanTechnica
energyIoTelectric-vehiclesbattery-technologysmart-transportationcharging-infrastructureautomotive-innovationNew Jersey Turnpike Tells EV Drivers — No Tesla Superchargers For You! - CleanTechnica
energyelectric-vehiclesEV-chargingTesla-SuperchargersNew-Jersey-Turnpikecharging-networkclean-energyEurope EV Sales Report — Sales Surge 33% YoY! * - CleanTechnica
energyelectric-vehiclesEV-salesplug-in-hybridsEuropeautomotive-marketbattery-electric-vehiclesTop Selling EV Brands & Auto Groups in Europe — April Sales Report - CleanTechnica
energyelectric-vehiclesEV-salesautomotive-industryEuropean-marketTeslaVolkswagenIdeology Accidentally Aligns with Reality: US $3.7B CCS Cancellation Explained - CleanTechnica
energycarbon-capturehydrogen-fuelsdecarbonizationfossil-fuelsclean-energyCCSHidden layer in solid-state batteries could unlock faster, safer power storage
energymaterialssolid-state-batteriesbattery-technologyion-transportsafer-batterieselectrochemistryThe 1st Electrostate, BYD Enters Argentina, EPA's Attack on Science — Top 12 Stories of the Week - CleanTechnica
energyclean-technologyelectric-vehiclessolar-powerrenewable-energyBYDEPABattery-free magic: US team creates jumping shells for seed dispersal
robotenergymaterialsseed-dispersalautonomous-structuresmetashellspolyethylene-terephthalateB.C. climate action has reduced emissions, with economic success - Clean Energy Canada
energyemissions-reductionclean-technologyelectric-vehiclesclimate-actionrenewable-energycarbon-taxDon’t Get Left In The Dark: EcoFlow's Home Backup Power Systems Are Up To 55% Off - CleanTechnica
energybackup-powersolar-energyportable-powerrenewable-energyhome-energy-systemsEcoFlowBreakneck data center growth challenges Microsoft’s sustainability goals
energysustainabilitycarbon-emissionsdata-centersmaterialsMicrosoftclean-energyLithium battery runs uninterrupted at 29,000 feet in -40°F for days
energylithium-batterylow-temperature-technologyscientific-equipmentpower-solutionscold-climaterenewable-energyNew tech reveals plasma turbulence secrets for nuclear reactors
energynuclear-fusionplasma-turbulencecomplex-systemsquantum-mechanicsfusion-reactorsmulti-field-analysisArizona Tribes Explore The Benefits Of Floating Solar - CleanTechnica
energyfloating-solarclean-energywater-conservationrenewable-energyColorado-RiverIndigenous-communitiesThe World Hit Another Clean Power Record Last Year
energyclean-powersolar-energydecarbonizationrenewable-resourcesclimate-goalsIcelandPeral's battery factory and Waterkeyn's Atomium still inspire modern tech culture
energybattery-technologyelectric-vehiclesinnovationengineeringhistorical-technologypower-plantsTech transfer in action: What we learned at Malaga's Foro Transfiere 2025
robotIoTenergytechnology-transfercognitive-therapyinnovationroboticsWhy Shipping’s Low-Carbon Future Relies More on Batteries & Biofuels Than Methanol - CleanTechnica
energylow-carbonmaritime-shippingdecarbonizationbiofuelsbatteriesmethanolCalifornia Has Over 15,000 MW Of Energy Storage - CleanTechnica
energyenergy-storageclean-energyCaliforniagrid-stabilitybattery-systemsrenewable-energyNew Agrivoltaic Showcases Sheep And Honeybees
energyagrivoltaicssolar-powersustainable-agriculturepollinatorsecosystemlivestockTokamaks could be prevented from overheating with X-point radiator
energyfusiontokamakplasmareactorefficiencyheat-managementUS nuclear fusion gets a 3D printing boost to fast-track construction
energynuclear-fusion3D-printingconstructionplasma-physicsmagnet-systemsNSTX-UChangan Solid State Battery Will Unlock Up To 1500 Miles Of Range - CleanTechnica
energysolid-state-batterieselectric-vehiclesbattery-technologyenergy-densityautomotive-innovationclean-energyWizz Air’s Sewage-to-Fuel Deal Helps Blow Up Five Energy Myths - CleanTechnica
energydecarbonizationaviationbiofuelsliquid-fuelselectrificationclimate-changeUS Offshore Wind Farm Gets Help From Heerema's Workhorse
energyoffshore-windrenewable-energyclean-electricityturbine-installationHeeremaEmpire-WindOf Course the New Volkswagen ID Model in China Is Its Best Looking! - CleanTechnica
electric-vehiclesVolkswagenenergyAI-voice-assistantBEVdriver-assistancecollaborationSpace Forge raises $30M Series A to make chip materials in space
materialsenergysemiconductorsspace-technologycrystal-growthmanufacturingaerospaceUltra-thin membrane unlocks 20% cheaper, greener hydrogen fuel power
hydrogenfuel-cellsenergymembrane-technologysustainabilitycost-reductiongreen-technologyWorld-record heavy lift vessel arrives in Rhode Island for wind project
energyoffshore-windwind-turbinescrane-vesselrenewable-energyconstructionEquinorAnalysts Say Trump Trade Wars Would Harm the Entire US Energy Sector, From Oil to Solar
energytrade-warstariffsrenewable-energyoil-and-gasUS-economyglobal-recession100 XCMG autonomous mining trucks begin operating in Inner Mongolia - The Robot Report
robotIoTenergyautonomous-vehiclessustainable-miningelectric-truckszero-carbon-technologyTrump administration to claw back $3.7B in clean energy and manufacturing awards
energyclean-energymanufacturinglow-carbon-materialscritical-mineralscement-productionnatural-gasYou’re In A New Paradigm! Behave Like It! - CleanTechnica
energyrenewable-energybatteriesclimate-changeelectricitypower-generationgrid-managementNew MONA M03 Max & Plus Get 12,566 Orders in One Hour! - CleanTechnica
IoTenergyrobotautonomous-vehiclesdriver-assist-technologysmart-transportationXPENGTesla Status Dropping in China as BYD Rises & Xiaomi Soars - CleanTechnica
energyelectric-vehiclesTeslaBYDXiaomiconsumer-trendsinnovationEurope Needs a Cleantech State Aid Overhaul — Starting with Production Incentives - CleanTechnica
energycleantechproduction-incentivesEU-policyrenewable-energyindustrial-policyprivate-investmentMagnetic fields supercharge catalysts for cleaner water and cheaper ammonia
energymaterialscatalystsammonia-productionwastewater-treatmentmagnetic-fieldselectrochemistryChinese firm's EV offers 830-mile range, charges 10-80% in 12 mins
energyelectric-vehiclesfast-chargingbattery-technologyautonomous-drivingsafety-standardsperformance-vehiclesWoman Sues Oil Companies For Causing Her Mother's Death - CleanTechnica
energyclimate-changefossil-fuelsoil-companieslawsuitenvironmental-impactheat-domeUS Hybrid Vehicle Sales Continue to Rise as Electric & Plug-in Vehicle Shares Remain Flat — GRAPHS - CleanTechnica
energyelectric-vehicleshybrid-vehiclesbattery-electric-vehiclesplug-in-hybridsclean-technologyautomotive-trendsNorway, A View from the Inside - CleanTechnica
energyelectric-vehiclesEV-transitionhydroelectric-powerbattery-technologyclean-airNorwayDARPA beams 800 watts laser power over record breaking 5.3 miles
energywireless-power-transmissionlaser-technologyDARPAmilitary-applicationsphotovoltaic-cellsoptical-power-beamingSuperfast EV battery boasts 80% charge in 12 mins, 310,000-mile life
energyelectric-vehiclesbattery-technologysustainable-energyfast-charginglithium-iron-phosphateEV-innovationMIT’s sodium fuel cell could fly electric planes while sucking CO2
energyfuel-cellelectric-aircraftsodium-air-batteryrenewable-energycarbon-captureenergy-densityRolls-Royce unveils monster 12-cylinder diesel engine for faster, greener superyachts
energysustainable-propulsionmarine-technologyRolls-Roycediesel-engineemissions-reductionrenewable-dieselDodge unveils world’s first all-electric muscle car with four doors
energyelectric-vehiclesmuscle-carsperformance-carsautomotive-technologyelectric-powertrainbattery-technologyNew 2D material could be used in electrochemical energy storage
materialsenergyelectrochemical2D-materialsboroncopper-boridenanomaterialsUS startup unveils prototype of excavator to mine helium-3 from moon
robotenergylunar-mininghelium-3autonomous-machineryspace-technologyexcavation-equipmentChina’s capacitor-free coil gun can fire 3,000 projectiles a minute, outpacing rivals
energymaterialsroboticslithium-ion-batterieselectromagnetic-coilscoil-gundirected-energy-weapon10x thicker EV battery electrodes with metal fleece offer 85% more power
energyEV-batteriesbattery-technologymetal-fleeceenergy-densitycharge-transportelectric-vehiclesHyundai, Kia, Genesis Meta Factory Visit Shows They Are Prepared For The Future - CleanTechnica
robotIoTenergyautomationelectric-vehiclesmanufacturingsmart-factoryEmpire Offshore Wind Project Back On, Pipeline Still Mothballed
energyoffshore-windrenewable-energyinfrastructurenatural-gasenvironmental-policyenergy-transitionBeyond the Harbor: Electrifying Short-Sea Routes and Hybridizing Blue-Water Shipping - CleanTechnica
energyelectrificationmaritimedecarbonizationbattery-technologyshippingsustainable-transportUK fusion device gets heating components to withstand extreme temperature
fusionenergyplasma-heatingtokamakmaterialselectromagnetic-wavesnuclear-fusionRoad Tripping To A Cleaner Future: Your Company’s Gear Could Be Part Of Our Next Big Story! - CleanTechnica
energysustainable-livingelectric-vehiclesclean-technologyenergy-efficiencysolar-poweroutdoor-gearAstrobotic, WiBotic test lunar wireless charging system - The Robot Report
robotIoTenergywireless-charginglunar-missionsAstrobotictechnologyRepurposed EV battery packs to power industries, supply 1.25 MW energy
energybattery-storagerenewable-energygrid-resiliencedecarbonisationEV-battery-packsclean-energyWant to Claim the Solar Tax Credit? Get Installing Now
energysolartax-creditphotovoltaicinstallationrenewable-energyenergy-policyRare graphite flakes behave as both superconductor and magnet at 300 K
materialssuperconductivitygraphenemagnetismenergyquantum-computingresearchChinese automaker unveils flagship hybrid SUV with 930-mile range
energyhybridSUVfuel-efficiencyintelligent-drivingadvanced-driver-assistancenew-energy-vehicleElectric Vehicles Top 5 Vehicle Classes in California — CHARTS - CleanTechnica
energyelectric-vehiclesEV-salesTeslaautomotive-industryclean-technologysustainable-transportationAgrivoltaics Benefit from Comparatively High Acceptance - CleanTechnica
energyagrivoltaicssolar-energyphotovoltaicssustainable-agriculturerenewable-energypublic-acceptanceInvestment Risk for Energy Infrastructure Construction Is Highest for Nuclear Power Plants, Lowest for Solar - CleanTechnica
energyconstruction-costsrenewable-energynuclear-powersolar-energyhydrogen-economyinfrastructure-projectsTotalEnergies Inaugurates its Largest Solar Field in Europe — in Spain - CleanTechnica
energysolar-powerrenewable-energyTotalEnergiessustainabilityelectricity-generationcarbon-emissionsAikido Technologies Full-Scale Floating Wind Demonstrator to Be Tested in Norway - CleanTechnica
energywind-energyoffshore-windrenewable-energyfloating-platformsAikido-TechnologiesMETCentreHERO’s Mission: An Elevator Part Could Bolster Marine Energy Technologies - CleanTechnica
energymarine-energywave-energy-converterspolyurethane-materialsdesalinationrenewable-energyocean-technologyTrump signs executive orders to revive US’ nuclear power leadership
energynuclear-powerreactor-technologyAI-data-centersuranium-miningregulatory-reformrenewable-energyYesterday’s Congressional Attack on Clean Transportation - CleanTechnica
energyelectric-vehiclesclean-transportationpollution-reductionclimate-actionzero-emission-technologiesautomotive-innovationIPHE Rejects Science On Hydrogen’s Indirect Warming, Raising Credibility Concerns - CleanTechnica
energyhydrogenclimate-changegreenhouse-gasclean-energyIPHEsustainabilityTechCrunch Mobility: Uber Freight’s AI bet, Tesla’s robotaxi caveat, and Nikola’s trucks hit the auction block
robotIoTenergyautonomous-vehiclestransportationTeslaUberSolar cells hit record 19.96% efficiency with 6x cheaper polymer
energysolar-cellsorganic-materialsefficiencysustainable-energypolymer-technologycost-reductionRooftop solar, EV batteries could meet 85% of Japan's energy needs
energysolar-energyelectric-vehiclesrenewable-energydecarbonizationenergy-self-sufficiencyrooftop-solarCalifornia prepares to sue feds after Senate revokes the state’s EV rule
energyelectric-vehicleszero-emissionsCaliforniaemissions-standardshydrogen-fuel-cellsbattery-electric-vehiclesLondon-New York in 45 mins: New hypersonic jet could fly 7x speed of sound
materialsenergyhypersonicaviationhydrogenaerospacetechnologyAgrivoltaics Makes The Leap From Rural To Urban Farming
energyagrivoltaicssolar-powerurban-farmingcommunity-solardecarbonizationsustainabilityKorea's busiest airport targets 1,100 EV charging stations by 2026
robotIoTenergyelectric-vehiclesautonomous-chargingAI-technologyEV-infrastructureThe Basics of IRA Subsidies and Why It’s Stupid to Kill Them - CleanTechnica
energyelectric-vehiclessolar-powersubsidiesInflation-Reduction-Actclean-technologyfossil-fuelsHyundai Motor Group & Incheon International Airport to Deliver Next-Level Convenience with AI-Powered EV Charging Robots - CleanTechnica
robotIoTenergyelectric-vehiclesAIsmart-airportfuture-mobilityIf Tesla Falls, Would That Hurt The EV Revolution? - CleanTechnica
robotEVTeslarobotaxisenergyclean-technologyautomotiveTrump’s Harvard Ban Echoes USSR’s Historic Mistake To China's Long-Term Gain - CleanTechnica
energyclean-technologysolar-energyelectric-vehiclesgeopolitical-influenceclimate-scienceenergy-storageScientists simulate how tens of thousands of electrons move in real time
materialsenergyquantum-mechanicselectron-dynamicsphotovoltaic-cellssimulationnanostructuresCrude oil climate toll slashed by 90% in US engineering breakthrough
energyemissions-reductioncrude-oilmembrane-technologysustainable-engineeringoil-processingMITThe Actual Reason the Tesla Cybertruck Has Failed? - CleanTechnica
energyelectric-vehiclesTeslaCybertrucksolid-state-batteriesElon-Muskclean-technologyMarine offshore platform gets solar boost to reduce 90% CO2 emissions
energysolar-poweroffshore-platformsustainabilitycarbon-emissionsautonomous-systemsrenewable-energyC-1 Recharged: Lit Motors Secures $1.6M To Further Develop Self-Balancing E-Motorcycle - CleanTechnica
robotIoTenergyelectric-vehicleurban-mobilityself-balancing-technologylow-carbon-transportationSenate votes to revoke California’s ability to set air pollution standards
energyzero-emissionselectric-vehicleshydrogen-fuel-cellsCalifornia-emissions-standardsenvironmental-policyclean-technologyAI Is Eating Data Center Power Demand—and It’s Only Getting Worse
energyAIdata-centerspower-demandgreenhouse-gas-emissionssustainabilityclimate-impact100% Solid-State EV Batteries Seal The Deal: No More Gasmobiles - CleanTechnica
energysolid-state-batterieselectric-vehiclessustainable-technologybattery-technologyautomotive-innovationmaterials-scienceCalifornia Has Far More EV Chargers Than Gas Stations - CleanTechnica
energyelectric-vehiclesEV-chargingsustainable-transportationCalifornia-energyzero-emission-vehiclescharging-infrastructureWhy The 6th Generation Toyota RAV4 Is Important For The EV Revolution - CleanTechnica
energyEVhybridplug-in-hybridfuel-economyautomotive-technologyToyota-RAV4Nuclear reactors, semiconductors to get smarter with next-gen US plasma tech
energyplasma-technologynuclear-reactorssemiconductor-manufacturingcomputational-physicsindustrial-processessimulation-toolsNACS 2025: It’s Happening! (Implications & Fallout) - CleanTechnica
energyelectric-vehiclesTeslacharging-infrastructureNorth-AmericaSuperchargerEV-standardsEV makers can cut rare earth use by 15% with new design tool: Study
energymaterialselectric-vehiclescircular-economyrare-earth-elementsremanufacturingsustainabilityWorld’s first offshore wind-solar project to generate 5x more power
energyoffshore-windsolar-powerrenewable-energyclean-electricityenergy-outputanchoring-systemNew nuclear reactor built for world's most powerful icebreaker
energynuclear-reactoricebreakerArctic-shippingRosatomRITM-400maritime-technologyJapan: Scientists develop new trick to trap ammonia from air, water
energyammonia-productionartificial-photosynthesiscatalystssustainable-agriculturecarbon-emissionsphotocatalysisVerified Benefits Empower Valuable Community Partnerships with Social RECs - CleanTechnica
energyrenewable-energycommunity-solarclean-energysocial-RECsenergy-transitionjob-trainingU.S. EIA Forecasts World Oil Consumption Growth to Slow Amid Less Economic Activity - CleanTechnica
energyoil-consumptioneconomic-growthglobal-tradecrude-oilenergy-forecastU.S.-EIAU.S. Hydropower Generation Expected to Rise in 2025 Following Last Year’s Relative Low - CleanTechnica
energyhydropowerelectricity-generationwater-supplyrenewable-energyprecipitation-patternsU.S.-energy-policyAlt Carbon scores $12M seed to scale carbon removal in India
energycarbon-removalclimate-techsustainable-agricultureenhanced-rock-weatheringenvironmental-impactIndiaSouth America Sets Historic Benchmark: Zero New Coal Plants Planned - CleanTechnica
energyrenewable-energycoalSouth-Americaclimate-changesolar-powerhydropowerPower Up: Redodo’s Memorial Day Sale Offers Up To 55% Off LiFePO₄ Batteries - CleanTechnica
energybatteriesLiFePO₄solar-powerenergy-storageBluetooth-technologyoff-grid-solutionsUS accelerator slashes power use by 80%, boosts beam brightness by 100x
energymaterialsaccelerator-technologybeam-brightnesspower-consumptionpermanent-magnetsresearch-innovationUnlocking Value From Existing Solar: SolMicroGrid’s Array-to-Microgrid Program - CleanTechnica
energysolarmicrogridenergy-managementbattery-storageEV-chargingrenewable-energyNew water flow battery hits 600 high-current cycles with no capacity loss
energybattery-technologysolar-energyflow-batteriesmaterials-scienceresidential-energy-storagerenewable-energyRide Into Summer: Heybike’s 4th Anniversary Sale Offers Massive E-Bike Savings - CleanTechnica
energye-bikeelectric-vehiclesustainable-transportcommutingbattery-technologymobilityLiving tattoos for buildings might turn urban walls into air purifiers
materialsenergypollutioncarbon-capturesustainable-architecturebioactive-surfacesurban-innovationBMW tests all-solid-state battery for extended range in i7 EV
energysolid-state-batterieselectric-vehiclesbattery-technologyBMWenergy-storageautomotive-innovationNext-gen nuclear reactors rely on solar salts for better heat control
energynuclear-reactorsthermal-energy-storagemolten-saltsadvanced-materialsradiation-resistancereactor-safetyAll Your Fleet Electrification & Range Anxiety Problems, Solved - CleanTechnica
energyelectrificationelectric-vehiclesrange-anxietymobile-chargingbattery-technologyfleet-managementTwo Leading Manufacturers Bring New Heat Pump Water Heater Updates To Market - CleanTechnica
energyheat-pumpwater-heaterefficiencysmart-technologyhome-efficiencyHVACJapan's new magnetic memory cuts power usage by 35% at record speed
energymemory-technologymagnetic-memorypower-consumptionSOT-MRAMenergy-efficiencyintegrated-circuitsPUR-1: First US nuclear reactor digital twin achieves 99% accuracy
energynucleardigital-twinAIremote-monitoringreactor-technologycarbon-free-electricityEaton And ChargePoint Aim Firepower At EV Charging Stations
energyEV-chargingelectric-vehiclesbidirectional-power-flowvehicle-to-everythinginfrastructure-solutionscommercial-fleet-vehiclesWindRunner: US eyes world’s largest plane for military cargo needs
energywind-energymilitary-logisticscargo-transportaerospacewind-turbinedual-use-technologyMIT’s super carbon sucking tech is 6 times faster, 20% cheaper than rivals
energycarbon-captureclimate-changeMITnanofiltrationCO2-removalsustainable-technologyGrain-sized cooling tech cuts energy use by 70%, doubles efficiency
energymaterialsthermoelectric-coolingrefrigeration-technologynanoengineeringefficiencysustainable-technologyU.S. Refining Industry Risks from 2025 Hurricane Season - CleanTechnica
energyhurricane-seasonU.S.-refining-industrypetroleum-supply-chainsweather-related-risksGulf-Coast-refineriesstorm-impactsSolar, Gas, & Battery: Why Apex 300’s 3-Part Backup Plan Is a Hurricane Season Must-Have - CleanTechnica
energysolar-powerbattery-backuphurricane-preparednessenergy-storagebackup-systemsrenewable-energyCalifornia EV Sales Stay Strong, Model Choice Skyrockets - CleanTechnica
energyelectric-vehicleszero-emission-vehiclesCalifornia-EV-marketclean-technologyautomotive-trendssustainable-transportationUnlock the Full Potential of Community Solar - CleanTechnica
energyrenewable-energycommunity-solarclean-energysolar-powergrid-resilienceenergy-independencePodbike Shuts Down: Norwegian E-Velomobile Startup Files For Bankruptcy - CleanTechnica
energyurban-mobilitye-bikemicromobilitysustainable-transportelectric-vehiclestartup-failureFirst all-solid-state battery line to set stage for next-gen EVs
energyelectric-vehiclessolid-state-batteriesbattery-technologyGotionEV-innovationenergy-densityHonda Changes Course On EVs, Will Switch Focus To Hybrids - CleanTechnica
energyhybrid-vehicleselectric-vehiclesautomotive-technologysustainable-transportationnet-zero-emissionssupply-chain-strategyNew CO₂-capturing battery stores 2.5x more energy, could power mars gear
energyCO₂-capturelithium-batteryrenewable-energyenergy-storageclean-technologyMars-explorationEcoFlow's Memorial Day & RV Sales: Unmatched Deals On Solar Generators, Batteries, & Power Stations - CleanTechnica
energysolar-powerportable-power-stationsoff-grid-livingbackup-powerrenewable-energyEcoFlowUK firm debuts world’s longest-range drone ship with 8,500-mile reach
robotIoTenergyautonomous-vesselshybrid-propulsionmaritime-technologyunmanned-systemsAligned Climate Capital's Largest Solar Fund Exceeds $200 Million Target - CleanTechnica
energysolarclean-energysustainabilityinvestmentcommunity-solarrenewable-energyLegion44 CDR Movie Continues To Gather Global Momentum - CleanTechnica
energycarbon-removalclimate-changeclean-technologysustainabilityenvironmental-awarenessinnovationMetal-free solar battery stores power for 2 days with 90% retention
energysolar-batteryorganic-materialsenergy-storagesustainable-technologysolar-harvestingcharge-retentionSodium Batteries: Yet Another Sign EVs Are Here To Stay
energysodium-batterieselectric-vehiclesEV-technologybattery-innovationsustainable-energyclean-transportationDrones could fly 30% farther with golf ball-style shape-shifting skin
robotIoTenergymaterialsdronesdrag-reductionmaneuverabilitySparkCharge raises $30M to help fleets electrify without commitments
energyelectric-vehiclescharging-infrastructurefleet-electrificationmobile-chargingrenewable-energysustainable-transportationUK: Top EV motor factory to power Ferrari, Lamborghini supercars
energyelectric-vehiclesaxial-flux-motorsmanufacturingautomotive-technologyprecision-engineeringsupercarsZEUS: US facility fires world’s most powerful laser at 2 petawatts
energylaser-technologymaterials-sciencequantum-physicsplasma-sciencescientific-discoveryhigh-field-scienceRepublican Bill in Congress Threatens 300 US Factories, 300,000 American Jobs - CleanTechnica
energysolar-energyrenewable-energyenergy-infrastructureclean-energyfossil-fuelsjob-lossTrump Loses Big Game Of Offshore Wind Chicken, Bigly
energyoffshore-windrenewable-energyconstructionEquinorTrump-administrationenergy-policyFrom Coal Dominance To Renewables: How Poland Changed Its Energy Story - CleanTechnica
energyrenewable-energyhydrogenenergy-transitionPolanddecarbonizationelectricity-gridIs BYD Touching Its Demand Ceiling at Home? — April 2025 Sales Report - CleanTechnica
energyelectric-vehiclesEV-salesBYDGeelyautomotive-industrymarket-analysisNew Texas Bill Threatens Growth Of Wind & Solar Industry - CleanTechnica
energyrenewable-energywind-powersolar-powergrid-reliabilityTexas-legislationenergy-policyGeely Xingyuan Takes Top Spot in China! — April 2025 Sales Report - CleanTechnica
energyelectric-vehiclesBEVPHEVautomotive-marketChinasales-reportGoogle inks another massive solar power deal to electrify its data centers
energysolar-powerrenewable-energydata-centerscarbon-footprintclean-powersustainabilityOn Sale Now: This Cargo E-Bike Can Carry Your Kids, Groceries, & More - CleanTechnica
energyelectric-bikee-bikesustainable-transportcargo-bikebattery-technologygreen-mobilityE-Bikes & E-Scooters on New Utah Trail Will Eliminate Fossil-Fuel-Burning Car Trips - CleanTechnica
energye-bikese-scootersfossil-fuelssustainable-transportationrecreationUtahVolkswagen Confirms MEB+ Platform Coming Soon - CleanTechnica
energybattery-technologyelectric-vehiclesLFP-batteriesVolkswagenMEB-platformautomotive-innovationTexas Welcomes More Solar Factories Despite Anti-Solar Bills
solarenergysolar-factoriesrenewable-energyTexassolar-panelsenergy-storageUS Electric Vehicle Buyer Decisions Survey Results From Experian - CleanTechnica
energyelectric-vehiclesbattery-lifehybrid-vehiclesconsumer-surveyEV-adoptioninfrastructureChina unveils world's first EV battery that hits refueling parity
energyelectric-vehiclesbattery-technologyfast-chargingEV-adoptionrange-anxietyShenzhen-International-Battery-FairBrain-like thinking AI chip with 100x less energy use developed
energyAI-chipneuromorphic-computingenergy-efficiencycybersecurityon-device-processingpattern-recognitionNikola’s hydrogen trucks hit the auction block
hydrogentrucksauctionenergyfuel-cellNikolatransportationFuturistic jet flies 3,600 miles with no windows and 50% less fuel
energyefficiencyaviationfuel-consumptionsustainable-designtechnologyinnovationA New Flow Battery Takes On The Data Center Energy Crisis
energyflow-batteryrenewable-energyenergy-storagedata-centerssustainable-technologyclean-technologyCanada firm's eVTOL becomes first to achieve full wing transition
robotIoTenergymaterialseVTOLhybrid-electricaviationCold Ironing Takes Hold: Ports Achieve Cleaner Air by Electrifying Ship Berths - CleanTechnica
energyelectrificationemissions-reductionclean-powersustainable-portsshore-powermaritime-sustainabilityUS scientists harvest electrical energy from human movement
energytriboelectric-generatorenergy-harvestingwearable-biosensorsmechanical-energypower-generationsensorsFlying taxi engines produce weird sound, but scientists have found a fix
energyelectric-vehiclesaviationnoise-reductionboundary-layer-ingesting-enginesgreen-technologyfuel-efficiencyUS’ laser-powered nuclear fusion achieves new net-positive energy records: Report
energynuclear-fusionlaser-technologypower-generationinertial-confinementenergy-yieldcontrolled-fusionPhotos: Fastest electric Hummer unveiled, reaches 0-60 mph in 2.8 secs
energyelectric-vehiclesHummer-EVbattery-technologyautomotive-innovationoff-road-technologyperformance-vehiclesUS' 1.3GW solar farm to power 200,000 homes, boost capacity by 20%
energysolar-powerrenewable-energyclean-energysolar-farmDoral-RenewablesBechtelMicrobes capture CO2, developed this trait by adopting harsh conditions
energyclimate-changecarbon-capturemicrobessustainabilityenvironmental-scienceextremophilesEV News From The US, Japan, China, And … Saudi Arabia?
energyelectric-vehiclesEV-adoptioncharging-infrastructurebattery-technologyconsumer-behaviorclean-energyPowering Ports: Electrifying Harbor Craft & Ferries For Lower Costs & Emissions
energyelectrificationdecarbonizationmaritime-industrybattery-electric-solutionsemissions-reductionharbor-tugsLaser-powered fusion experiment more than doubles its power output
energyfusionnuclear-energypower-outputlaser-technologyinertial-confinementclimate-technologyWhy I Don’t Have An EV Right Now, & When I’ll Get One Again
energyelectric-vehiclesEVtransportationcharging-infrastructuresustainable-mobilityautomotive-technologyQuả cầu bêtông 400 tấn lưu trữ năng lượng dưới biển sâu
energyrenewable-energyenergy-storageunderwater-technologyFraunhofer-InstituteStEnSeasustainable-energyĐội xe khai thác mỏ tự động lớn nhất thế giới
robotIoTenergyautomationelectric-vehiclesmining-technologyartificial-intelligenceEVNSPC trao đổi kinh nghiệm về kiểm tra giám sát mua bán điện điều chỉnh phụ tải với EVNNPC và EVNHANOI
energyelectricityload-managementpower-monitoringdemand-responseutility-companiesenergy-efficiencyNIO Launches Big Upgrades to Top Selling EC6 & ES6
energyelectric-vehiclesEV-upgradesbattery-technologysmart-technologyautomotive-innovationNIOTesla Brand Image Plunges Amidst Regulatory Questions & Competitors’ Rising Approval Ratings
energyelectric-vehiclesTeslaautomotive-industryclean-technologyrenewable-energymarket-trendsUtility-Scale Outshining Rooftop Solar As Global Solar Market Explodes
energysolar-powerrenewable-energyutility-scale-solarelectricity-generationphotovoltaic-systemsclean-technologyOpenAI’s planned data center in Abu Dhabi would be bigger than Monaco
energydata-centerAI-infrastructurepower-consumptionAbu-DhabiOpenAIG42A Perfect Storm For Energy Is Coming To The US
energyclean-powernuclear-poweroil-and-gascoalrenewable-energyenergy-transitionThe Nuclear Company raises $51M to develop massive reactor sites
energynuclear-powerreactorselectricitydata-centerspower-generationrenewable-energySAF Startup To Leverage Green Hydrogen And Captured Carbon
energygreen-hydrogencarbon-capturesustainable-aviation-fuelrenewable-energybiomasselectrofuels17 High-Powered Electric Truck Chargers To Be Installed At Three UK Sites
energyelectric-vehiclescharging-infrastructurezero-emissionfleet-electrificationhigh-powered-chargerslogisticsThe Nuclear Company raises $46M to develop massive reactor sites
energynuclear-powerreactorselectricitydata-centerspower-generationrenewable-energySolar & Storage Industry Statement on Proposed Reconciliation Legislation in U.S. House Committee Markups
energysolar-powerclean-energyenergy-policyenergy-securityrenewable-energysolar-industryTổng công ty Điện lực miền Nam 50 năm xây dựng và phát triển
energyelectricitypower-supplyrenewable-energyinfrastructureenergy-developmentelectricity-distributionChuyên gia hạt nhân Dubna làm việc với Viện Năng lượng Nguyên tử Việt Nam
energynuclear-energyVietnamcollaborationatomic-energysustainable-developmentenergy-policyTrên 300 cây xanh được trồng thêm tại Nhà máy Nhiệt điện Vĩnh Tân 2
energyrenewable-energyenvironmental-sustainabilityclimate-changepower-generationtree-plantingVinh-Tan-2US EIA Forecasts World Oil Consumption Growth to Slow Amid Less Economic Activity
energyoil-consumptioneconomic-growthglobal-tradeenergy-forecastcrude-oilliquid-fuelsKinh nghiệm quốc tế chuyển từ FIT sang đấu thầu và cơ chế khác cho năng lượng tái tạo Gợi ý với Việt Nam
energyrenewable-energyFITauction-mechanismenergy-policyclimate-changeenergy-transitionArcher: Official Air Taxi Provider of the LA28 Olympic & Paralympic Games & Team USA in Exclusive Deal
energyeVTOLtransportationLA28Archer-AviationOlympic-GamesvertiportUruguay EV Sales Report: At 17.6% BEV Market Share in April, We Have a New Leader in Latin America!
energyEVBEVmarket-shareelectric-vehiclesUruguayclean-technologyThủ tướng Phạm Minh Chính tiếp Chủ tịch Tập đoàn Hoa Điện Trung Quốc
energyrenewable-energyclean-energyhydropowerenergy-storageenergy-policysustainable-developmentNew Toyota bZ Woodland for US Market
energyelectric-vehicleBEVcarbon-neutrallithium-ion-batteryToyotaautomotive-technologyThe Hype Returns: Joe Romm & Michael Barnard Revisit Hydrogen, 20 Years Later
energyhydrogenclimate-changesustainabilityclean-technologyemissions-reductionrenewable-energySYNCRAFT Wins Energy Globe Award For Breakthrough In Activated Carbon Usage
energyactivated-carbonwastewater-treatmentsustainable-technologyenvironmental-innovationbiomass-powerclean-energyMid-Drive Muscle Under $2.5K? Ride1Up’s Prodigy V2 E-Bike Just Got Even Cheaper
energye-bikemid-drive-motorelectric-vehiclesustainable-transportationbattery-technologycommutingClimeworks’ DAC & Fiscal Collapse & The Brutal Reality Of Pulling Carbon From The Sky
energycarbon-capturedirect-air-captureclimate-technologyemissions-reductionthermodynamicsrenewable-energyA Desert Journey With Heybike’s ALPHA Mid-Drive Fat Tire E-Bike
energye-bikemid-drive-motorelectric-bikesustainable-transportationfat-tire-bikeclean-technologyHow To Build A Non-Disposable EV
energyelectric-vehiclessustainabilitylongevityclean-technologyautomotive-innovationplanned-obsolescenceStartup pin cát Việt được đầu tư một triệu USD
energyrenewable-energythermal-storagecarbon-reductiongreen-technologysolar-energystartup'Việt Nam tiến tới làm chủ công nghệ năng lượng hạt nhân'
energynuclear-energygreen-energyenergy-technologyenergy-policyVietnam-energyatomic-energyPowering the Future: A 30-Year Roadmap to Zero-Emission Port Operations
energydecarbonizationelectrificationshippingport-operationsrenewable-energycarbon-emissionsEV Sales in Australia — April Update
energyelectric-vehiclesEV-salesAustraliaplug-in-hybridsBEVPHEVTNB Malaysia đề xuất EVN hợp tác kết nối lưới điện khu vực qua biển và đất liền
energyrenewable-energyelectricity-transmissioncarbon-neutralitysolar-powerASEAN-cooperationenergy-infrastructurePhân tích vai trò hydrogen trong quá trình khử carbon ngành lọc hóa dầu và công nghiệp nặng
energyhydrogencarbon-reductionindustrial-emissionsclean-energyenergy-transitionlow-emission-hydrogenGet 50% Off These EcoFlow Power & AC Bundles — Perfect For Off-Grid Adventures
energysolar-powerportable-poweroff-grid-livingclimate-controlsmart-energy-techbattery-technologyIEA Global EV Outlook 2025 Shows US Falling Further Behind On Electric Cars
energyelectric-vehiclesEV-salesrenewable-energyIEAclean-technologybattery-technologyVolvo’s 1st Extended-Range Electric Vehicle Coming Soon
energyelectric-vehicleplug-in-hybridVolvosustainable-transportationclean-technologyautomotive-innovationWhy Modern Cities Are Embracing Trolleybuses Again
energysustainable-transportationelectric-busesurban-transitdecarbonizationsmart-technologyregenerative-brakingGM, Ford Tease New Game Changing LMR EV Batteries … But Where Is Waldo?
energyEV-batterieslithium-manganesematerials-scienceautomotive-technologyTeslaFord4 More NIO Houses, 112 More Power Swap Stations & Charging Stations
energybattery-swapcharging-stationsNIOsustainable-technologyelectric-vehiclesclean-energyEVNGENCO2 và CSG LMI hợp tác phát triển thủy điện tích năng tại Việt Nam
energyhydropowerrenewable-energyenergy-storagesustainable-developmentVietnamenergy-efficiencyEVNGENCO2 và CSG LMI Trung Quốc ký bản ghi nhớ hợp tác phát triển thủy điện tích năng
energyhydropowerrenewable-energyenergy-storagesustainable-developmentelectricity-generationinternational-cooperation15 Years & Counting: A Unique Solution for Transportation Data Sharing
energytransportationdata-sharingGPS-technologyrenewable-energyprivacy-concernsmobility-researchXPENG Partners with Plugsurfing to Secure Powerful Charging Network
energyEV-chargingXPENGPlugsurfingcharging-networksmart-chargingelectric-vehiclesKý hợp đồng tín dụng đầu tư của nhà nước dự án nâng công suất Trạm biến áp 500kV Hòa Bình
energypower-transmissioninvestment-projectelectrical-infrastructureenergy-capacityrenewable-energypower-gridThúc đẩy chuyển dịch năng lượng tái tạo Việt Nam chủ động tìm lời giải công nghệ và chính sách
energyrenewable-energyVietnamenergy-policysustainable-developmentenergy-transitionclean-technologyBước phát triển mới trong hợp tác dầu khí Việt Nam Liên bang Nga
energyoil-and-gasinternational-cooperationVietnamRussiaenergy-securitysustainable-developmentWill Hydrogen Fuel Cell Trucks Just Follow The Hydrogen Car Storyline?
hydrogenfuel-cellstrucksbattery-electricenergytransportationclean-technologyLG Dualcool AI Air - điều hòa với hai khe thổi gió
IoTenergysmart-homeair-conditioningLGDualcool-AIenergy-efficiencyTình hình đàm phán giá năng lượng tái tạo chuyển tiếp cập nhật 14 5 2025
energyrenewable-energyenergy-transitionpower-purchase-agreementsenergy-policyelectricity-marketenergy-projectsThe EV Benefit on Road Trips You Really Can’t Talk About
energyelectric-vehiclesEV-chargingroad-tripsclean-technologysustainable-travelconvenienceShaq Ditched His Tesla Cybertrucks For This New EV — And Why
energyelectric-vehiclesEV-adoptionCadillac-Escalade-IQTesla-CybertruckShaquille-O'Nealautomotive-technologyThe Bluetti AC60 Is On Sale For Just $269: Get A Pro-Grade Power Station At A Budget Price
energypower-stationportable-powersolar-chargingoutdoor-gearemergency-preparednessbattery-technologyClimeFi Launches Analyst Rating Coverage On Deep Sky’s Tech-Agnostic DAC Projects
energycarbon-removaldirect-air-capturesustainabilitytechnology-agnosticclimate-innovationCO₂-removalVertical Aerospace has a plan to capitalize on Europe’s defense tech moment
robotIoTenergyeVTOLhybrid-electricdefense-technologyaerospaceHouse GOP wants to cut parts of the Inflation Reduction Act while sparing others
energyclean-energyelectric-vehiclescarbon-capturebattery-storageInflation-Reduction-Actsustainable-aviation-fuelGM’s new ‘manganese rich’ battery promises cheaper EVs in 2028
energymaterialselectric-vehiclesbattery-technologyGeneral-Motorslithium-manganese-richcost-reductionPhòng thí nghiệm Anh tạo ra chất làm lạnh mới trong điều hòa
energymaterialscooling-technologybarocaloric-materialsgreenhouse-gas-reductionenergy-efficiencysustainable-coolingRealta Fusion taps $36M in fresh funds for its fusion-in-a-bottle reactor
energyfusionclean-energypower-plantsplasma-technologyrenewable-energyenergy-innovationEVNGENCO1 thăm và tặng quà người lao động Công ty Nhiệt điện Quảng Ninh
energyelectricity-productionrenewable-energypower-generationenergy-securityworkforce-motivationtechnological-innovationCông ty Điện lực Cà Mau trong hành trình 50 năm sau ngày giải phóng
energyelectricityinfrastructurerenewable-energyclimate-changepower-distributionrural-electrification4 Months with the Chery Omoda E5
energyelectric-vehiclebattery-managementclean-technologysustainable-transportationautomotive-technologyChery-Omoda-E5America Closed For Business: Bill Rolling Back IRA Provisions Will Slash Investment
energyclean-energyinvestmentindustrial-policyrenewable-energyhydrogen-productionelectric-vehiclesElectric Depots: The Key To Electrifying Road Logistics
energyelectrificationbattery-electric-vehiclescharging-infrastructurelogisticsdepot-chargingsustainable-transportUBND tỉnh Đồng Nai phê duyệt cho EVN thuê đất mở rộng dự án Thủy điện Trị An
energyhydropowerrenewable-energyelectricity-generationclimate-changeenergy-efficiencyinfrastructure-developmentNhập khẩu năng lượng từ Liên bang Nga Cơ hội và thách thức của Việt Nam kỳ 1
energyenergy-importVietnamRussiaenergy-strategyrenewable-energyenergy-managementCalifornia Opposes Rooftop Solar For All The Wrong Reasons
energysolar-powerrooftop-solarutility-ratesCalifornia-energy-policyclean-energyelectricity-generationNorway Has More Energy Transition Plans In The Works
energyEVoffshore-windenergy-storagecharging-stationsbattery-innovationrenewable-energySlate Auto crosses 100,000 refundable reservations in two weeks
energyelectric-vehiclesEV-startupsustainable-transportationautomotive-industryreservationspickup-truckHySpeed Green Hydrogen Play Will Lead To Stranded Assets & Fiscal Losses
energyhydrogendecarbonizationgreen-energyrenewable-energyinfrastructureemissions-reductionSyncraft Opens Clean Power Plant That Provides Electricity, Heat, & CDR
energyclean-energycarbon-dioxide-removalbiomassrenewable-energybiochargasificationUK Startup IDs A New Hope For Algae Biofuel: Carbon-Negative Production
energybiofuelcarbon-capturerenewable-energymicroalgaeclean-technologygreenhouse-gas-emissionsHệ thống drone kiểm tra thần tốc đường dây điện
droneinspectionenergyautomationtechnologytransmission-linesefficiencyĐánh giá mô hình quản lý chất lượng và an toàn trong bảo dưỡng sửa chữa các công trình năng lượng tại Việt Nam
energymaintenancequality-managementindustrial-systemsdigital-transformationreliabilitysafetyCông ty Mỹ tuyên bố khai thác helium-3 trên Mặt Trăng
robotenergyhelium-3lunar-miningspace-resourcesadvanced-reactorsquantum-computingEVNHANOI tăng tốc phát triển lưới điện đảm bảo cấp điện tin cậy cho Thủ đô
energysmart-gridelectricity-supplyrenewable-energyurban-developmentpower-infrastructureenergy-managementEVs Take 32.1% Share In The UK – Volkswagen Leads
energyelectric-vehiclesEV-marketbattery-electric-vehiclesplug-in-hybridsUK-automotive-industryclean-transportationCông ty Mỹ khai thác helium-3 trên Mặt Trăng
robotenergyhelium-3lunar-miningspace-resourcesadvanced-reactorsquantum-technologyGeneral Motors Has a Promising Strategy for Export Markets with Chinese-Made EVs — But What’s Taking So Long?
energyelectric-vehiclesEV-strategyGeneral-MotorsChinese-EVsaffordable-EVsautomotive-industryCuộc đua khai thác năng lượng từ lòng đất
energygeothermal-energyclean-energydrilling-technologyrenewable-resourcesenergy-productionsustainable-energyElectrified Cars From Volvo & Cupra That May Or May Not Come To America
energyelectric-vehiclesplug-in-hybridVolvosustainable-transportationautomotive-technologyelectrificationSurging Solar Power, Booming EV Sales, & Robotaxi Safety — Top 12 Stories of the Week
robotIoTenergysolar-powerelectric-vehiclesrobotaxisclean-technologyTham khảo một số Luật Năng lượng Nguyên tử trên thế giới
energynuclear-energyenergy-policyenergy-regulationclean-energyenergy-securityatomic-energyThe #1 Benefit of EV Life is the #1 Thing People Worry About
energyelectric-vehiclesEV-chargingclean-energysustainable-transportbattery-technologycharging-infrastructureHiệu ứng bí ẩn đe dọa trang trại điện gió
energywind-farmrenewable-energyoffshore-windenergy-productionclimate-goalswind-theftNăng lượng Nhật Bản kỳ 86 Nhân lực điện hạt nhân của các nước đi đầu và vấn đề của Việt Nam
energynuclear-energyrenewable-energycarbon-reductionbiodieselJapan-energy-policyenergy-transitionĐập thủy điện cao nhất thế giới bắt đầu trữ nước
robotIoTenergyhydropowerclean-energyconstruction-technologyenvironmental-monitoringA New Tesla? No, Here Comes Faraday Future (Eventually)
energyelectric-vehiclesEV-technologyaffordable-EVsautomotive-innovationFaraday-Futuresustainable-transportationMyths, Misinformation, & Misunderstandings About EV Charging & Range
energyEV-chargingbattery-managementelectric-vehiclescharging-mythsrange-misconceptionsclean-technologyMercedes-Benz EV Fast Chargers Rolling Into A Town Near You
energyEV-chargingrenewable-energyclean-technologyMercedes-Benzelectric-vehiclescharging-networkLò phản ứng Trung Quốc lập kỷ lục hoạt động lâu nhất
energynuclear-energyCANDU-reactorcarbon-emissions-reductionpower-generationrenewable-energyenergy-efficiencyGetting Big Batteries (BESS) & Pumped Hydro (PHES) to Play Well Together
energybatteriespumped-hydrorenewable-energyenergy-storagegrid-managementbattery-technologyEVNGENCO1 triển khai đồng bộ nhiều giải pháp đảm bảo điện mùa khô năm 2025
energyelectricityrenewable-energypower-generationenergy-securityenergy-managementtechnological-innovationSiêu máy tính 200.000 GPU của Elon Musk
energyGPUsupercomputerAITeslapower-consumptionenvironmental-impactContract Chaos: Texas’ Retroactive Energy Bill Shakes Market Trust
energyrenewable-energyTexas-energy-marketenergy-legislationinvestor-confidenceenergy-contractsregulatory-stabilityThe Real Impact Of Power Station Alternator Chargers
energysolar-powerpower-stationclean-technologyhybrid-systemsvehicle-chargingoutdoor-recreationBYD BEV Sales Up 46% in April
energyelectric-vehiclesBEVPHEVrenewable-energysales-growthBYDSolar Gets Cheaper, Systems Get Bigger: EnergySage Report Maps A Shifting Market
energysolarstorageclean-energymarket-trendsTeslapricingSolar Power Has Surged in “Trump States” in 2020s
energysolar-powerrenewable-energyclean-energysolar-capacityenergy-policyenergy-investmentTechCrunch Mobility: Tesla denied ‘Robotaxi’ trademark, Aurora loses a co-founder, and tariffs start to take a toll
robotIoTself-drivingtransportationAuroraTeslaenergyVinFast Pounces On EV Sales Growth In Europe
energyelectric-vehiclesEV-salesVinFastautomotive-industryEuropedealership-modelGoogle inks deal to develop 1.8 GW of advanced nuclear power
energynuclear-poweradvanced-reactorsdata-centersrenewable-energysmall-modular-reactorspower-generationHow Losing National EV Tax Credits Could Impact Southwestern US States
energyelectric-vehiclesEV-market-shareclean-energysustainabilitytransportationSouthwest-USEVs take 97.4% share in Norway
energyelectric-vehiclesNorwaybattery-electric-vehiclesclean-technologyautomotive-industrysustainable-transportationTrao đổi của EVN về điều chỉnh giá điện tháng 5 2025 và các tác động đến từng nhóm khách hàng
energyelectricity-pricingnuclear-energyEVNenergy-policyconsumer-impactenergy-regulationCơ chế cho nguồn điện sử dụng khí trong nước và LNG nhập khẩu Nghị định 100 2025
energynatural-gaselectricity-generationrenewable-energypower-systemsenergy-policythermal-powerQuy định chi tiết về cơ chế cho các dự án điện sử dụng khí trong nước và LNG nhập khẩu
energynatural-gaselectricity-generationrenewable-energyenergy-policythermal-powerenergy-regulationCharging Up On the Rivian Adventure Network
energycharging-networkrenewable-resourceselectric-vehiclesfast-chargingsustainabilityRivianEU Battery Due Diligence Rules: Are Carmakers Ready?
energybatteriessustainabilityelectric-vehiclessupply-chainEU-regulationsclimate-changeEVNSPC thí điểm giải thể điện lực cấp huyện thành lập đội quản lý điện
energyelectricity-managementrenewable-energypower-systemsenergy-restructuringutility-managementenergy-efficiencyEVNHANOI đẩy mạnh tiếp nhận tài sản công trình nâng cao tỷ lệ bán lẻ điện trực tiếp
energyelectricitypower-distributioncustomer-serviceinfrastructure-developmentrenewable-energysmart-gridNREL Partners With Chilkat Indian Village To Improve Housing in Klukwan, Alaska
energyrenewable-energyhousing-improvementcarbon-monoxide-safetyair-qualityNRELcommunity-developmentBàn về Dự thảo Luật Năng lượng Nguyên tử Việt Nam sửa đổi
energynuclear-energyenergy-policyVietnamsafety-regulationsenergy-lawatomic-energyAcePower Launches New 50 kW Air-Cooled High-Efficiency Module to Accelerate Europe’s Fast-Charging Network Expansion
energycharging-infrastructurehigh-efficiency-modulesilicon-carbide-technologyfast-chargingpower-conversiongrid-stability5 Myths About Solar + Storage
solarenergyrenewable-energysolar-storagegrid-resilienceclean-energyenergy-costsMicrogrids Could Enhance Grid Resilience
energymicrogridsgrid-resiliencerenewable-energydisaster-recoveryelectricity-demandlocal-energy-solutionsThe Top 5 States in the USA for Solar Power
energysolar-powerrenewable-energyclean-energysolar-capacitysolar-jobssolar-companiesLos Angeles’ Car-Free Olympics Is Possible — If We Let The Private Sector In
energytransportationelectric-bikesurban-mobilityprivate-sectorinfrastructuresustainabilityThe Bluetti Apex 300: Scalable Power, Smarter Energy, & A Step Beyond Backup
energyenergy-storagesolar-powersmart-energy-managementbackup-powermodular-designoff-grid-solutionsChina’s Geely moves to take EV startup Zeekr private amid trade war with US
robotIoTenergyEVautonomous-vehiclesGeelyZeekrWhy Losing ENERGY STAR Would Be A Tragedy For The US
energyenergy-efficiencyENERGY-STARenergy-savingsconsumer-appliancesenvironmental-policyutility-incentivesNREL Researcher Craig Turchi Brings Small Business Experience to Big Concentrating Solar Projects
energysolar-powerconcentrating-solar-powerthermal-energyrenewable-energyenergy-efficiencyNRELTiến độ các dự án giải tỏa công suất Nhiệt điện Nhơn Trạch 3 và 4 cập nhật 8 5 2025
energypower-transmissionrenewable-energyenergy-securityinfrastructure-projectselectricity-gridenergy-managementWhat’s Required To Install A Source Hydropanel?
energywater-harvestingclean-technologysustainable-livingoff-grid-solutionshydropanelsinstallation-processPVN cùng đối tác Azerbaijan hợp tác thăm dò khai thác dầu khí và cung cấp dầu thô
energyoilcollaborationAzerbaijanVietnamPetrovietnamexplorationTiến độ các dự án hạ tầng thuộc Trung tâm Điện lực Quảng Trạch cập nhật 8 5 2025
energypower-plantrenewable-energyinfrastructure-projectsenergy-managementconstruction-progresssafety-measuresEVNGENCO1 bứt phá từ phát triển khoa học đổi mới sáng tạo và chuyển đổi số
energyinnovationtechnologydigital-transformationpower-generationscientific-developmentefficiencyCalifornia’s New Hydrogen Subsidy Sinkhole: 13 Cars, Millions Spent, Negative Impact
energyhydrogenclean-transportationzero-emission-vehiclesCaliforniasubsidiescarsharingTầm nhìn chính sách năng lượng Việt Nam Tham khảo gợi ý của chuyên gia quốc tế
energyrenewable-energyenergy-policysustainable-developmentVietnam-energynuclear-energyclimate-changeAcePower Launches New 50 kW Air-Cooled High-Efficiency Module to Accelerate Europe’s Fast-Charging Network Expansion
energychargingefficiencysilicon-carbidefast-charginginfrastructurepower-conversionEcoFlow STREAM Ultra: A Game-Changer For Plug-&-Play Home Solar Systems
energysolarbattery-storageclean-technologyresidential-energymodular-designrenewable-energyTrump administration plans to shutter money-saving Energy Star program
energyEnergy-Starenergy-efficiencyhousehold-energy-costsEPAclimate-technologyenergy-savingsTrump admin plans to shutter money-saving Energy Star program
energyEnergy-Starenergy-efficiencyhousehold-energy-costsEPAclimate-technologypublic-private-partnershipFord hikes Mustang Mach-E price due to Trump’s tariffs
energyelectric-vehiclesMustang-Mach-Etariffsautomotive-industryEV-pricingFordBreathe lands $21M Series B to predict battery performance
energybattery-performanceelectric-vehiclesautomotive-technologypredictive-modelingsoftware-developmentcharging-strategiesEVs Take 63.3% Share In Sweden – Renault 5 Starts Climbing
energyEVBEVPHEVelectric-vehiclesautomotiveSwedenNhững điểm mới quan trọng tại Dự thảo Luật Năng lượng nguyên tử sửa đổi
energynuclear-energyenergy-policysafety-regulationssustainable-energyenergy-strategyatomic-energyPhê duyệt khung giá phát điện cho loại hình nhà máy thủy điện tích năng năm 2025
energyhydropowerelectricity-pricingrenewable-energyenergy-policyenergy-generationenergy-marketXe tải lai tàu hỏa tự động
robotIoTenergysustainable-transportautonomous-vehicleslogisticsgreen-supply-chainU.S. Sustainable Aviation Fuel Production Takes Off As New Capacity Comes Online
energysustainable-aviation-fuelbiofuelsrenewable-energyU.S.-energy-policyclean-technologyalternative-fuelsMaking EU State Aid Work for Clean Manufacturing
energyclean-technologyindustrial-decarbonisationEU-state-aidclimate-neutralityrenewable-energysustainable-manufacturingCan Quantum Computers Handle Energy’s Hardest Problems?
energyquantum-computingNRELenergy-storagepower-grid-reliabilitycomputational-problemsadvanced-computingĐóng điện Trạm biến áp 110kV Nam Cấm dự án sử dụng vốn ưu đãi từ Chính phủ Đức
energypower-gridrenewable-energyenergy-efficiencyinfrastructure-developmentelectricity-supplysmart-gridGlobal EV Sales — EVs Now 21% of World Auto Sales in 2025
energyelectric-vehiclesEV-saleselectrificationbattery-electric-vehiclesautomotive-marketclean-technologyTriển vọng và thách thức của hydrogen phát thải thấp trong chiến lược chuyển đổi năng lượng toàn cầu
energyhydrogenrenewable-energygreenhouse-gas-reductionenergy-transitioncarbon-capturelow-emission-technologyRivian earnings: EV maker cuts delivery guidance because of Trump’s tariffs and trade wars
energyelectric-vehiclesEVsautomotive-industrytariffscapital-expenditureRivianConnecticut Struggles To Reconcile The High Cost Of Electricity With A Push For Renewables
energyrenewable-energyelectricity-ratessolar-incentivesnuclear-powerenergy-legislationConnecticutCosta Rica’s EV Market in 2024: A Review for the Leader of the Americas
energyelectric-vehiclesEV-marketbattery-electric-vehiclessustainable-transportationclean-technologyCosta-RicaMeet The Lectric XP4: A Folding E-Bike That Doesn’t Compromise
energye-bikeelectric-vehiclesustainable-transportationbattery-technologyclean-energymobilityGoogle Launches Ambitious Program To Train 100,000 Electrical Workers For The AI-Powered Future
energyAIworkforce-developmentclean-energyelectrical-traininginfrastructureinnovationCan the Cadillac Celestiq EV make GM’s luxury brand great again? Don’t rule it out
energyelectric-vehicleCadillacluxury-carbattery-technologyautomotive-design3D-printingGreening My Life: What’s Done, & What’s Left To Do
energysolar-powerrenewable-energyenergy-efficiencyelectric-vehiclesnet-meteringclean-technologyShell Subsidiary sonnen Heats Up Virtual Power Plant Race In Texas
energyvirtual-power-plantTexas-electricity-gridenergy-storagesolar-energygrid-stabilityrenewable-energyAviation Professionals Call For A New Flight Plan On Emissions
energyemissionsaviationclimate-changesustainable-aviation-fuelscarbon-footprintfossil-fuels'Trái tim' của lò phản ứng nhiệt hạch lớn nhất thế giới
energyfusionITERsuperconducting-magnetsclean-energytokamakplasmaCnaught wants to make carbon credits easy for businesses small and large
energycarbon-creditssustainabilityclimate-changemarket-solutionssmall-businessescarbon-marketNew Škoda Concept EV Reads The Room, And The Room Loves DEI
energyelectric-vehiclesEVbattery-technologysustainable-transportationautomotive-innovationdiversity-in-techKế hoạch giảm lệ thuộc nước ngoài về nhiên liệu hạt nhân của Hoa Kỳ
energynuclear-energyuranium-enrichmentrenewable-energyenergy-supply-chainsustainable-developmentenergy-policyAVEVA PI System Giúp doanh nghiệp tăng khả năng cạnh tranh nhờ làm chủ dữ liệu
energyIoTdata-analyticsreal-time-monitoringautomationsustainabilityindustrial-processesTony Blair’s New Climate Reset Report Promotes Delay, Not Action
energyclimate-changefossil-fuelsclimate-policytechnology-solutionssustainabilityenvironmental-impactHow Do You Sell an EV into Australia’s Crowded Market?
energyelectric-vehiclesEV-marketingfast-chargingclean-technologyAustralian-marketautomotive-innovationBlue States Sue Feds Over Halt To Wind Energy Projects
energywind-energyrenewable-energyclean-energyfederal-regulationsenergy-policyjob-creationLG dùng AI để cải thiện hiệu suất điều hòa
energyAIsmart-sensorsenergy-efficiencycooling-systemsLG-ThinQDual-Inverter-CompressorTesla Cybertruck Tips & Tricks After First 15,000 Miles
robotIoTenergyTeslaCybertruckoff-roadbattery-managementFitch Ratings xếp hạng tín nhiệm EVNNPT ngang bằng với tín nhiệm quốc gia
energyrenewable-energypower-transmissioninvestmentenergy-planningcredit-ratingEVNNPTRivian Aims To Cement Future EV Sales With New Park For Suppliers
energyelectric-vehiclesEV-manufacturingsupply-chaininnovation-hubRiviansupplier-parkTesla Cybertruck Review After 15,000 Miles
robotIoTenergyautonomous-vehiclesTeslaCybertruckclean-technologyPhát triển Cơ chế hỗ trợ giá FIT cho năng lượng tái tạo Việt Nam Lịch sử thành tựu thách thức
energyrenewable-energyfeed-in-tariffsolar-powerwind-energyVietnam-energy-policyenergy-investmentLayoffs hit General Fusion as the fusion power startup runs short on cash
fusionenergystartupplasmacommercial-powerfundingGeneral-FusionRevving Up Refurbished E-Bikes: Upway Expands With Los Angeles UpCenter
energye-bikessustainable-transportationcircular-mobilityurban-mobilityrefurbished-bikesclean-technologyUS Consumers Don’t Trust Tesla Anymore, Study Says
energyelectric-vehiclesconsumer-trustTeslaEV-marketautomotive-industrycharging-infrastructureUS Defense Department Launches Bioeconomy Plan Against Fossil Fuels
energybioeconomymaterialsindustrial-competitivenessadvanced-materialsbio-based-productsDefense-DepartmentTrung Quốc hồi sinh công nghệ lò phản ứng muối nóng chảy thorium
energythoriumnuclear-reactorChinamolten-salt-reactorrenewable-energyenergy-production31 đội tranh tài tại chung kết Sáng kiến Khoa học 2025
energyrecyclingsolar-panelsinnovationsustainabilityenvironmental-protectionbiomassScientists Have Just Discovered a New Type of Electricity-Conducting Bacteria
energyelectricitybacteriaconductivitybiological-wireCandidatus-Electrothrixenvironmental-scienceMáy bay Anh lập kỷ lục bay liên tục lâu nhất thế giới
robotIoTenergymaterialsdronesolar-powercommunicationGiảm phát thải và duy trì nguồn cấp điện tin cậy từ máy phát điện Diesel
energygreenhouse-gas-emissionsdiesel-generatorsrenewable-energyenvironmental-regulationsenergy-transitionsustainable-developmentGóc nhìn độc lập về Cơ chế hỗ trợ giá FIT cho điện gió mặt trời Việt Nam
energyrenewable-energywind-powersolar-energyVietnam-energy-policyWhat Caused The Blackout On The Iberian Peninsular? It’s Complicated.
energyblackoutrenewable-energyelectrical-gridsolar-powerwind-powerIberian-PeninsulaLào khởi công dự án thủy điện 124 MW đấu nối hệ thống điện Việt Nam
energyhydropowerrenewable-energyelectricity-generationLaosinfrastructureeconomic-developmentLào khởi công dự án thủy điện 124 MW đối nối hệ thống điện Việt Nam
energyhydroelectric-powerrenewable-energyelectricity-generationLaosinfrastructure-developmentclean-energyEPS đảm bảo công tác sửa chữa bảo dưỡng các nhà máy điện đầu năm 2025
energymaintenancepower-plantsreliabilityremote-monitoringoperational-efficiencymachine-learningPhân tích sự cố mất điện trên bán đảo Iberia và một số khuyến nghị cho Việt Nam
energyrenewable-energypower-outageIberiaenergy-transitionelectricity-gridenergy-securityCập nhật tiến độ dự án giải tỏa công suất Nhà máy điện Nhơn Trạch 3 ngày 5 5 2025
energyrenewable-energypower-transmissionNhon-Trach-3electricity-supplyconstruction-projectenergy-infrastructureTrump Attacks on Loan Program that Sustained Tesla, EV Charging Program, Fuel Economy Standards — What Next?
energyelectric-vehiclesclean-technologyrenewable-energyfossil-fuelsbattery-productionEV-chargingPhân tích chi tiết sự cố mất điện trên bán đảo Iberia và một số khuyến nghị cho Việt Nam
energyrenewable-energypower-outageenergy-transitionelectricity-gridenergy-securityIberiaSAF Takes Off & Ticket Prices Follow: The Real Cost Of Greener Air Travel
energysustainable-aviation-fueldecarbonizationelectric-aviationcarbon-emissionsaviation-industrygreen-hydrogenNew Home EV Charging Solution Tells Gasmobiles: Get Off My Fleet!
energyEV-chargingfleet-electrificationhome-chargingelectric-vehiclessustainable-transportationreimbursement-systemElectric Cars Are More Reliable Than Gas Cars — New Study
energyelectric-vehiclesEV-reliabilityautomotive-technologyclean-transportationsustainable-energybattery-technologyEVs At 25.3% Share In France – Renault Top Two
energyelectric-vehiclesEV-marketbattery-technologysustainable-transportationemissions-reductionRenaultHệ thống điện Tây Ban Nha 1 ngày không dùng nhiên liệu hóa thạch và sự cố mất điện trên bán đảo Iberia
energyrenewable-energyelectricity-gridenergy-transitionpower-outageSpainIberiaNew Data On Fossil Fuel Industry Emissions Could Play Pivotal Role In Climate Litigation
energyclimate-changefossil-fuelsemissionscarbon-footprintsustainabilityclimate-litigation'Cơn sốt' trung tâm dữ liệu AI đang chững lại?
energydata-centersAIMicrosoftAmazonelectricity-consumptioncapacity-managementTàu điện lớn nhất thế giới với pin 250 tấn hạ thủy
energysustainable-transportelectric-shipbattery-technologymaritime-innovationlow-emissionsrenewable-energyHệ thống điện Tây Ban Nha 1 ngày không dùng nhiên liệu hóa thạch và sự cố mất điện diện rộng Đâu là nguyên nhân
energyrenewable-energypower-systemselectricitySpainenergy-transitionblackoutWith a Technology License from MIT and NREL in Hand, Comstock Fuels Aims to Produce Jet Fuel from Lignin
energybiomasssynthetic-fuelaviation-fuelrenewable-resourceshydrocarbonsligninNREL-Led Research Effort Adds Salt, Boosts Performance of Perovskites
energysolar-cellsperovskiterenewable-energyphotovoltaic-technologyefficiencydurabilityPipelines To Nowhere: The Real Costs Of TMX & The Dutch Hydrogen Network
energyhydrogeninfrastructurepipelinesCanadaNetherlandsmegaprojectsBlink Charging & Create Energy Team Up To Offer Solar-Powered EV Charging Solution
energysolar-powerelectric-vehiclesEV-chargingrenewable-energybattery-storageenergy-managementEarly Owner Reviews of Volkswagen ID. Buzz — CleanTechnica Video
energyelectric-vehiclesVolkswagen-ID.-Buzzclean-technologyEV-chargingsustainable-transportationElectrify-AmericaUS Offshore Wind Industry Lives To Fight Another Day
energyoffshore-windrenewable-energyclean-energyenergy-policywind-powerenergy-industryAra Partners’ new $800M fund will decarbonize old industrial assets
energydecarbonizationclimate-techindustrial-assetsinfrastructure-fundcarbon-emissionsinvestmentCalifornia’s Energy Revolution: Sunrun Quadruples Virtual Power Plant Ahead Of Summer
energyvirtual-power-plantdecentralized-powerCalifornia-energyelectricity-demandrenewable-energybackup-powerInterview With Carbon Removal India CEO Asitava Sen On Scaling CDR In India
energycarbon-removalclimate-changesustainable-agricultureagribusinessIndiaCDRSuper-Efficient Air Conditioning Technology Slashes Energy Costs
energyair-conditioningelectricity-consumptionCO2-emissionsclean-technologyclimate-changeenergy-efficiencyModular Construction Enables Efficient & Affordable Housing
energymodular-constructionbuilding-efficiencyrenewable-energyaffordable-housingNRELair-leakageEnergy Technology Innovation Partnership Project Opens Applications To Support Coastal, Remote, & Island Communities
energyenergy-technologyrenewable-energyenergy-planningcoastal-communitiesremote-communitiesenergy-securityBidgely Surpasses 1.5 TWh of Energy Savings, Offsetting 1M Tons of CO2 Emissions
energyenergy-efficiencyCO2-emissionselectric-vehicleshome-energy-managementcustomer-engagementclean-technologyGreasing the Wheels of the Energy Transition to Address Climate Change & Fossil Fuels Phaseout
energyclimate-changerenewable-energyenergy-transitionfossil-fuelselectrificationenergy-modelsHydrogen’s Harsh Reality: Plug Power, Ballard, and FuelCell Near the End?
energyhydrogenfuel-cellsPlug-PowerCleanTechsustainabilityfinancial-analysisCông ty Nhiệt điện Duyên Hải Một thập kỷ đóng góp cho an ninh năng lượng quốc gia
energypower-generationenergy-securityrenewable-energyeconomic-developmentenergy-managementBYD Launches In Benin, Seychelles, Croatia, Slovakia, & Cambodia, Plus The World’s Largest Car Carrier!
energyelectric-vehiclesBYDclean-technologytransportationsustainable-mobilitymarket-expansionWhat Caused the European Power Outage?
energypower-outageelectricity-gridgrid-stabilityenergy-productioninfrastructureblackoutUK Councils To Government: Rooftop Solar Should Be Required On All New Homes
energysolar-energyrooftop-solardecarbonizationbuilding-standardsrenewable-energyUK-councilsPorts, Fuels, & Emissions: How Trump’s Tariffs Are Reshaping Maritime Trade
energyemissionsmaritime-tradefuel-consumptionclimate-changeshipping-routesalternative-powerRepublicans Want A New $250 Tax On Electric Vehicles
energyelectric-vehiclestax-policytransportationclean-technologyInterview with Amina Mević: Machine learning applied to semiconductor manufacturing
robotIoTenergymaterialsmachine-learningsemiconductor-manufacturingvirtual-metrologyPure Lithium Announces Engagement with Kingston Process Metallurgy to Scale Lithium Metal Anode Production
lithiumbattery-technologyenergymaterialselectroplatingproductionmetallurgy1 Millionth Electric Vehicle Rolls off the Production Line at the Volkswagen Plant in Zwickau
energyelectric-vehiclesVolkswagensustainable-transportationautomotive-industrye-mobilityclean-technologyHow to Defuse the EU’s Carbon Tax Time Bomb
energycarbon-pricingclean-energyEU-regulationssustainabilityenvironmental-policyenergy-costsBYD Seagull to Start Production in Brazil Next June
energyproductionBYDBrazilclean-technologyelectric-vehiclesmanufacturingThe Geopolitics Of Critical Minerals: China’s Grip & The West’s Response
energycritical-mineralsdecarbonizationrenewable-energyindustrial-policiesgreen-hydrogenbattery-technologiesDow’s Collaboration With Jaguar TCS Racing At Miami E-Prix — A Focus On Thermal Management
energythermal-managementFormula-Ecollaborationelectric-vehiclessustainabilityDowPanasonic Steps Away From Solar & Storage, Ends EverVolt Line
energysolarbattery-storagePanasonicrenewable-energyclean-technologyresidential-energyRivian’s reportedly sitting on a stockpile of tariff-free batteries
energybatteriesRivianelectric-vehiclestariffslithium-iron-phosphatesupply-chainDiễn đàn quốc tế năng lượng Việt Nam Trung Quốc ASEAN 2025
energyrenewable-energyASEANVietnamChinacarbon-reductionenergy-cooperationTriển lãm quốc tế năng lượng Việt Nam Trung Quốc ASEAN 2025
energyrenewable-energyASEANcarbon-reductioninternational-exhibitionVietnamChinaPhase-Shifting Hot Bricks Pack More Energy Storage Punch Into Smaller Spaces
energyenergy-storagethermal-energyrenewable-energysolar-energywind-energyindustrial-processes